Recombinant Human MACF1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MACF1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 95 of Human MACF1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MACF1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00023499-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MACF1 Protein

  • microtubule-actin crosslinking factor 1

Background

MACF1 - microtubule-actin crosslinking factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-11220
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
H00056899-P01
Species: Hu
NBP2-00714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84928
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006474-M01
Species: Hu, Rt
Applications: WB, ELISA, RNAi
H00009167-B02P
Species: Hu
Applications: WB, ELISA
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-21395
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP1-33415
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
H00002620-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF4885
Species: Mu
Applications: WB, IP
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85568
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready

Publications for MACF1 Partial Recombinant Protein (H00023499-Q01)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for MACF1 Partial Recombinant Protein (H00023499-Q01) (0)

There are no reviews for MACF1 Partial Recombinant Protein (H00023499-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MACF1 Partial Recombinant Protein (H00023499-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MACF1 Products

Bioinformatics Tool for MACF1 Partial Recombinant Protein (H00023499-Q01)

Discover related pathways, diseases and genes to MACF1 Partial Recombinant Protein (H00023499-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MACF1 Partial Recombinant Protein (H00023499-Q01)

Discover more about diseases related to MACF1 Partial Recombinant Protein (H00023499-Q01).
 

Pathways for MACF1 Partial Recombinant Protein (H00023499-Q01)

View related products by pathway.

PTMs for MACF1 Partial Recombinant Protein (H00023499-Q01)

Learn more about PTMs related to MACF1 Partial Recombinant Protein (H00023499-Q01).
 

Research Areas for MACF1 Partial Recombinant Protein (H00023499-Q01)

Find related products by research area.

Blogs on MACF1

There are no specific blogs for MACF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

APC Antibody
NB100-91662
MACF1 Antibody (1G9)
H00023499-M08
CLASP2 Antibody
NBP1-21395

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MACF1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MACF1