LYZL6 Antibody


Western Blot: LYZL6 Antibody [NBP1-82810] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with more
Immunohistochemistry-Paraffin: LYZL6 Antibody [NBP1-82810] - Staining of human testis shows strong cytoplasmic positivity in subsets of seminiferus duct cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

LYZL6 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: CNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRP
Specificity of human LYZL6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LYZL6 Protein (NBP1-82810PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for LYZL6 Antibody

  • EC
  • LYC1lysozyme homolog
  • lysozyme-like 6
  • lysozyme-like protein 6
  • PRO1485
  • TKAL754
  • UNQ754


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC-P, IP, Flow-CS
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for LYZL6 Antibody (NBP1-82810) (0)

There are no publications for LYZL6 Antibody (NBP1-82810).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYZL6 Antibody (NBP1-82810) (0)

There are no reviews for LYZL6 Antibody (NBP1-82810). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LYZL6 Antibody (NBP1-82810) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional LYZL6 Products

Bioinformatics Tool for LYZL6 Antibody (NBP1-82810)

Discover related pathways, diseases and genes to LYZL6 Antibody (NBP1-82810). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LYZL6

There are no specific blogs for LYZL6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LYZL6 Antibody and receive a gift card or discount.


Gene Symbol LYZL6