Home » LYPLA2 » LYPLA2 Antibodies » LYPLA2 Antibody (3H5)

LYPLA2 Antibody (3H5)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: LYPLA2 Antibody (3H5) [H00011313-M01] - Analysis of LYPLA2 expression in transfected 293T cell line by LYPLA2 monoclonal antibody (M01), clone 3H5.Lane 1: LYPLA2 transfected lysate (Predicted MW: 24.7 KDa).Lane 2: Non-transfected lysate.
Western Blot: LYPLA2 Antibody (3H5) [H00011313-M01] - Analysis of LYPLA2 expression in transfected 293T cell line by LYPLA2 monoclonal antibody (M01), clone 3H5.Lane 1: LYPLA2 transfected lysate (Predicted MW: 24.7 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3H5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

LYPLA2 Antibody (3H5) Summary

Immunogen
LYPLA2 (NP_009191, 144 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
Specificity
LYPLA2 - lysophospholipase II
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LYPLA2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LYPLA2 Antibody (3H5)

  • acyl-protein thioesterase 2
  • APT2
  • DJ886K2.4
  • EC 3.1.2
  • EC 3.1.2.-
  • LPL-II
  • lysophospholipase IIAPT-2LysoPLA II

Background

Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

LYPLA1 Antibody
(JE47-60)
NBP2-80466
Western Blot: LYPLA1 Antibody (JE47-60) [NBP2-80466] - Analysis of Lysophospholipase 1 on mouse stomach tissue lysate. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody at 1:500 was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature.
Immunohistochemistry-Paraffin: LYPLA1 Antibody (JE47-60) [NBP2-80466] - Immunohistochemical analysis of paraffin-embedded rat kidney tissue using anti-Lysophospholipase 1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody at 1:200 for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Immunohistochemistry-Paraffin: LYPLA1 Antibody (JE47-60) [NBP2-80466] - Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue using anti-Lysophospholipase 1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody at 1:200 for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Phospholipase B1
Antibody
H00151056-B01P
Western Blot: Phospholipase B1 Antibody [H00151056-B01P] - Analysis of PLB1 expression in transfected 293T cell line by PLB1 polyclonal antibody. Lane 1: PLB1 transfected lysate(46.53 KDa). Lane 2: Non-transfected lysate.
(1 Publication)
Species: Hu, Mu
Applications: WB
PLA2G4A Antibody
NBP1-31344
Immunocytochemistry/Immunofluorescence: PLA2G4A Antibody [NBP1-31344] - Analysis of HeLa, using NBP1-31344 at 1:200 dilution.
Immunohistochemistry-Paraffin: PLA2G4A Antibody [NBP1-31344] - U87 xenograft, using PLA2G4A antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: PLA2G4A Antibody [NBP1-31344] - Sample (30 ug of whole cell lysate) A: NIH-3T3 7.5% SDS PAGE; antibody diluted at 1:1000.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TAP1 Antibody (3D4)
H00006890-M04
Flow Cytometry: TAP1 Antibody (3D4) [H00006890-M04] - Intracellular flow cytometric analysis of TAP1 antibody H00006890-M04 (orange filled) on interferon gamma treated HCT116 cells. Red dotted line in histogram represents unstained and blue filled line represents isotype control. Flow cytometry image added from a verified customer review.
Immunocytochemistry/Immunofluorescence: TAP1 Antibody (3D4) [H00006890-M04] - Analysis of monoclonal antibody to TAP1 on HeLa cell. Antibody concentration 10 ug/ml
(1 Review)
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
Fas/TNFRSF6/CD95
[HRP]
DFS00
(1 Review)
(17 Publications)
Species: Hu
Applications: ELISA
APRT Antibody
NBP1-89519
Immunohistochemistry-Paraffin: APRT Antibody [NBP1-89519] - Staining of human kidney shows moderate cytoplasmic positivity in tubule cells.
Immunocytochemistry/Immunofluorescence: APRT Antibody [NBP1-89519] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Western Blot: APRT Antibody [NBP1-89519] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-41
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PLA, WB
EGR1 Antibody (6E8)
H00001958-M03
Western Blot: EGR1 Antibody (6E8) [H00001958-M03] - Analysis of EGR1 expression in transfected 293T cell line by EGR1 monoclonal antibody (M03), clone 6E8. Lane 1: EGR1 transfected lysatE (59.73 KDa). Lane 2: Non-transfected lysate.
Western Blot: EGR1 Antibody (6E8) [H00001958-M03] - EGR1 monoclonal antibody (M03), clone 6E8. Western Blot analysis of EGR1 expression in Raw 264.7.
Western Blot: EGR1 Antibody (6E8) [H00001958-M03] - EGR1 monoclonal antibody (M03), clone 6E8. Western Blot analysis of EGR1 expression in PC-12.
(2 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
14-3-3 zeta
Antibody (818515) [Un ...
MAB2669
Simple Western lane view shows lysates of SH‑SY5Y human neuroblastoma cell line, loaded at 0.5 mg/mL. A specific band was detected for 14‑3‑3 zeta at approximately 34 kDa (as indicated) using 2 µg/mL of Mouse Anti-Human 14‑3‑3 zeta Monoclonal Antibody (Catalog # MAB2669). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of SH‑SY5Y human neuroblastoma cell line,SK‑Mel‑28 human malignant melanoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, and C6 rat glioma cell line. PVDF membrane was probed with 0.2 µg/mL of Mouse Anti-Human14‑3‑3 zeta  Monoclonal Antibody (Catalog # MAB2669) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for14‑3‑3 zeta at approximately 27 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
14‑3‑3 zeta  was detected in immersion fixed paraffin-embedded sections of human squamous cell carcinoma using Mouse Anti-Human 14‑3‑3 zeta Monoclonal Antibody (Catalog # MAB2669) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to nuclei and plasma membrane. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
Species: Hu
Applications: IHC, Simple Western, WB
PLA2G1B Antibody
(630823)
MAB5018
Western blot shows lysates of human pancreas tissue. PVDF Membrane was probed with 2 µg/mL of Human PLA2G1B Monoclonal Antibody (Catalog # MAB5018) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for PLA2G1B at approximately 17 kDa (as indicated). This experiment was conducted under non-reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: IP, WB
GAP-43 Antibody
NB300-143
Immunocytochemistry/Immunofluorescence: GAP-43 Antibody [NB300-143] - Cortical neuron-glial cell culture from E20 rat stained with rabbit pAb to GAP43, dilution 1:2,000 in green, and costained with mouse mAb to vimentin, dilution 1:2,000, in red. Blue: DAPI staining of nuclear DNA. GAP43 antibody labels protein expressed in the axonal membrane of neuronal cells, while vimentin antibody stains intermediate filaments in fibroblasts and other non-neuronal cells.
Western Blot: GAP-43 Antibody [NB300-143] - Different tissue and cell lysates using rabbit pAb to GAP43, dilution 1:20,000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord, [6] SH-SY5Y cells, [7] C6 cells. Single band at 43 kDa mark corresponds to GAP43 protein. The GAP43 protein is detected only in the lysates of neuronal origin. C6 cells are a rat glioma cell line and do not express GAP43 protein
Immunohistochemistry-Paraffin: GAP-43 Antibody [NB300-143] - Posterior MOE sections at approximately the same region where EOG was recorded were obtained from control and Skn-1a-/- mice exposed to either water or chemicals for 2 wks. The sections were immunoreacted with antibodies against GAP43 and OMP and stained with DAPI. Confocal images were taken from olfactory turbinate II. Similar morphology and marker expression were found in four groups of mice, indicating there was no obvious tissue damage in both control and Skn-1a-/- mice after chemical exposure in the posterior MOE regions where EOG recordings were performed. Scale bar: 50 um. Image collected and cropped by CiteAb from the following publication (http://eneuro.sfn.org/lookup/doi/10.1523/ENEURO.0135-17.2017), licensed under a CC-BY licence.
(1 Review)
(80 Publications)
Species: Bv, Ca, Ch, Dr, Eq, Hu, Mu, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB

PLA2G7/PAF-AH/Lp-PLA2
DPLG70
(1 Review)
(13 Publications)
Species: Hu
Applications: ELISA
LYPLAL1 Antibody
NBP1-92090
Simple Western: LYPLAL1 Antibody [NBP1-92090] - Lane view shows a specific band for LYPLA1 using 200 ug/mL of Sk-Mel-28 cell lysate and 1:4 antibody dilution. Electropherogram image of corresponding Simple Western lane view at WES molecular weight of 32 kDa. Image from an internal validation.
Immunocytochemistry/Immunofluorescence: LYPLAL1 Antibody [NBP1-92090] - Staining of human cell line U-251 MG shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: LYPLAL1 Antibody [NBP1-92090] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules and in glomeruli.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western
ZDHHC22 Antibody
NBP2-58832
Immunocytochemistry/Immunofluorescence: ZDHHC22 Antibody [NBP2-58832] - Staining of human cell line U-2 OS shows localization to plasma membrane.
Species: Hu
Applications: ICC/IF
ZDHHC23 Antibody
NB100-56149
Immunohistochemistry-Paraffin: ZDHHC23 Antibody [NB100-56149] - ZDHHC23 was detected in immersion fixed paraffin-embedded sections of human colon using Rabbit Anti-Human ZDHHC23 polyclonal Antibody (Catalog # NB100-56149) at 1:1000 for 1 hour at room temperature followed by incubation with the Anti-Rabbit IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC003). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to the cytoplasm and plasma membrane in gladular cells.
Species: Hu
Applications: IHC, IHC-P, IP, WB

Cardiotrophin-1/CT-1
612-CD/CF
Cardiotrophin-1/CT-1
(7 Publications)
Species: Hu
Applications: BA
TMEM103 Antibody
NBP1-91733
Immunohistochemistry: TMEM103 Antibody [NBP1-91733] - Low expression levels of ELP6 was highly associated with poor overall survivals in GBC patients. Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41467-019-13420-x) licensed under a CC-BY licence.
Western Blot: TMEM103 Antibody [NBP1-91733] - The integrity and stability of the Elongator complex are required for gemcitabine-induced cytotoxic effects in GBC cells. a ELP5 depletion significantly downregulated the protein levels of other Elongator subunits, including ELP1, ELP2, ELP3, ELP4, ELP6. b ELP5 depletion significantly decreased ATPase activity in NOZ cells. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41467-019-13420-x) licensed under a CC-BY licence.
Western Blot: C3orf75/ELP6 Antibody [NBP1-91733] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Plexin A1 Antibody
[Unconjugated]
AF4309
Plexin A1 was detected in immersion fixed frozen sections of embryonic mouse spinal cord using Mouse Plexin A1 Affinity-purified Polyclonal Antibody (Catalog # AF4309) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Plexin A1 was detected in immersion fixed immature human dendritic cells using Goat Anti-Mouse Plexin A1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4309) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Western blot shows lysates of mouse embryonic heart tissue. PVDF Membrane was probed with 1 µg/mL of Mouse Plexin A1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4309) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Plexin A1 at approximately 200 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
(5 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
PPT2 Antibody
NBP2-94272
Western Blot: PPT2 Antibody [NBP2-94272] - Analysis of extracts of mouse liver, using PPT2 at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.
Immunohistochemistry-Paraffin: PPT2 Antibody [NBP2-94272] - Paraffin-embedded mouse heart using PPT2 .
Species: Hu, Mu
Applications: IHC, IHC-P, WB

Publications for LYPLA2 Antibody (H00011313-M01) (0)

There are no publications for LYPLA2 Antibody (H00011313-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYPLA2 Antibody (H00011313-M01) (0)

There are no reviews for LYPLA2 Antibody (H00011313-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LYPLA2 Antibody (H00011313-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LYPLA2 Products

Bioinformatics Tool for LYPLA2 Antibody (H00011313-M01)

Discover related pathways, diseases and genes to LYPLA2 Antibody (H00011313-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LYPLA2 Antibody (H00011313-M01)

Discover more about diseases related to LYPLA2 Antibody (H00011313-M01).
 

Pathways for LYPLA2 Antibody (H00011313-M01)

View related products by pathway.

PTMs for LYPLA2 Antibody (H00011313-M01)

Learn more about PTMs related to LYPLA2 Antibody (H00011313-M01).

Blogs on LYPLA2

There are no specific blogs for LYPLA2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LYPLA2 Antibody (3H5) and receive a gift card or discount.


Bioinformatics

Gene Symbol LYPLA2
Entrez
Uniprot