Recombinant Human LYPLA1 Protein

Product Discontinued

Recombinant Human LYPLA1 Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acids 66-151 of Human LYPLA1 partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:NVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRAS

• Preparation Method: in vitro wheat germ expression system
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: LYPLA1

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LYPLA1 Protein

• acyl-protein thioesterase-1
• APT1
• APT-1
• EC 3.1.2
• EC 3.1.2.-
• EC 3.1.2.22
• hAPT1
• LPL1
• LPL1acyl-protein thioesterase 1
• LPL-I
• LYPLA1
• Lysophospholipase 1
• Lysophospholipase I
• lysophospholipase ILYSOPLA
• lysophospholipid-specific lysophospholipase
• LysoPLA I

Background

Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LYPLA1