LRRN3/NLRR-3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LRRN3/NLRR-3 Antibody [NBP2-30614] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: LRRN3/NLRR-3 Antibody [NBP2-30614] - Staining of human lateral ventricle shows strong positivity in astrocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRRN3/NLRR-3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QNNLSSVTNINVKKMPQLLSVYLEENKLTELPEKCLSELSNL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRRN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LRRN3/NLRR-3 Protein (NBP2-30614PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRRN3/NLRR-3 Antibody

  • FIGLER5
  • immunoglobulin and leucine rich repeat domains 5
  • leucine rich repeat neuronal 3
  • leucine-rich repeat neuronal protein 3
  • leucine-rich repeat protein, neuronal 3
  • LRRN3
  • Neuronal leucine-rich repeat protein 3
  • NLRR3
  • NLRR-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4990
Species: Hu, Mu
Applications: WB, IHC
NBP2-45795
Species: Hu
Applications: WB, IHC
AF3760
Species: Hu
Applications: WB
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84686
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46627
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15563
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34104
Species: Hu
Applications: IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-76877
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for LRRN3/NLRR-3 Antibody (NBP2-30614) (0)

There are no publications for LRRN3/NLRR-3 Antibody (NBP2-30614).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRN3/NLRR-3 Antibody (NBP2-30614) (0)

There are no reviews for LRRN3/NLRR-3 Antibody (NBP2-30614). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LRRN3/NLRR-3 Antibody (NBP2-30614) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRRN3/NLRR-3 Products

Bioinformatics Tool for LRRN3/NLRR-3 Antibody (NBP2-30614)

Discover related pathways, diseases and genes to LRRN3/NLRR-3 Antibody (NBP2-30614). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRN3/NLRR-3 Antibody (NBP2-30614)

Discover more about diseases related to LRRN3/NLRR-3 Antibody (NBP2-30614).
 

Pathways for LRRN3/NLRR-3 Antibody (NBP2-30614)

View related products by pathway.

PTMs for LRRN3/NLRR-3 Antibody (NBP2-30614)

Learn more about PTMs related to LRRN3/NLRR-3 Antibody (NBP2-30614).

Blogs on LRRN3/NLRR-3

There are no specific blogs for LRRN3/NLRR-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRN3/NLRR-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRN3
Entrez
Uniprot