Recombinant Human LR8 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LR8 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-270 of Human TMEM176B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTQNTVIVNGVAMASRPSQPTHVNVHIHQESALTQLLKAGGSLKKFLFHPGDTVPSTARIGYEQLALGVTQILLGVVSCVLGVCLSLGPWTVLRASGCAFWAGSVVIAAGAGAIVHEKHPGKLAGYISSLLTLTGFATAMAAVVLCVNSFIWQTEPFLYIDTVCDRSDPVFPTTGYRWMRRSQENQWQKEECRAYMQMLRKLFTAIRALFLAVCVLKVIVSLVSLGVGLRNLCGQSSQPLNEEGSEKRLLGENSVPPSPSREQTSTAIVL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TMEM176B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LR8 Protein

  • LR8FLJ26014
  • LR8-like protein
  • MGC110857
  • Protein LR8
  • transmembrane protein 176B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-83283
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-07101
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, ICC/IF
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81689
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP2-46539
Species: Hu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF

Publications for LR8 Recombinant Protein (H00028959-P01) (0)

There are no publications for LR8 Recombinant Protein (H00028959-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LR8 Recombinant Protein (H00028959-P01) (0)

There are no reviews for LR8 Recombinant Protein (H00028959-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LR8 Recombinant Protein (H00028959-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LR8 Products

Bioinformatics Tool for LR8 Recombinant Protein (H00028959-P01)

Discover related pathways, diseases and genes to LR8 Recombinant Protein (H00028959-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LR8 Recombinant Protein (H00028959-P01)

Discover more about diseases related to LR8 Recombinant Protein (H00028959-P01).
 

Pathways for LR8 Recombinant Protein (H00028959-P01)

View related products by pathway.

Blogs on LR8

There are no specific blogs for LR8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LR8 Antibody
NBP2-13446

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LR8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM176B