Lipocalin-1 Antibody (1B11)

Images

 
Western Blot: Lipocalin-1 Antibody (1B11) [H00003933-M02] - Analysis of LCN1 expression in transfected 293T cell line by LCN1 monoclonal antibody (M02), clone 1B11.Lane 1: LCN1 transfected lysate(19.25 KDa).Lane 2: ...read more
Sandwich ELISA: Lipocalin-1 Antibody (1B11) [H00003933-M02] - Detection limit for recombinant GST tagged LCN1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1B11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Lipocalin-1 Antibody (1B11) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
LCN1 (NP_002288, 24 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCE
Specificity
LCN1 - lipocalin 1 (tear prealbumin) (1B11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LCN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Lipocalin-1 Antibody (1B11)

  • LCN1
  • lipocalin 1 (tear prealbumin)
  • lipocalin 1-like 2
  • Lipocalin1
  • Lipocalin-1
  • MGC71975
  • PMFA
  • Tear lipocalin
  • Tear Prealbumin
  • TLC
  • TPVon Ebner gland protein
  • VEG protein
  • VEGP
  • VEGPlipocalin 1 (protein migrating faster than albumin, tear prealbumin)

Background

The protein encoded by this gene belongs to the lipocalin family. Lipocalins are a group of extracellular proteins that are able to bind lipophiles by enclosure within their structures to minimize solvent contact. This protein may bind hydrophobic ligands and inhibit cysteine proteinases. It may also play a role in taste reception. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2737
Species: Hu
Applications: ICC/IF, IHC, IP, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP3-08882
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PA, WB
H00001806-M01
Species: Hu
Applications: DB, ELISA, ICC/IF, WB
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB5170
Species: Hu
Applications: Block, Simple Western, WB
NBP2-02710
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-22439
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00005729-B01P
Species: Hu
Applications: Flow, ICC/IF, WB
NLS1049
Species: Eq, Hu, Pm, Po, Pm
Applications: ICC, ICC/IF, IHC, IHC-P
NBP3-13522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF2009
Species: Hu
Applications: ICC, IHC
MAB9080
Species: Hu
Applications: WB
AF4779
Species: Hu
Applications: IHC, WB
AF2905
Species: Hu
Applications: ELISA, ICC, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
H00003933-M02
Species: Hu
Applications: WB, ELISA

Publications for Lipocalin-1 Antibody (H00003933-M02) (0)

There are no publications for Lipocalin-1 Antibody (H00003933-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lipocalin-1 Antibody (H00003933-M02) (0)

There are no reviews for Lipocalin-1 Antibody (H00003933-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lipocalin-1 Antibody (H00003933-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lipocalin-1 Products

Diseases for Lipocalin-1 Antibody (H00003933-M02)

Discover more about diseases related to Lipocalin-1 Antibody (H00003933-M02).
 

Pathways for Lipocalin-1 Antibody (H00003933-M02)

View related products by pathway.

PTMs for Lipocalin-1 Antibody (H00003933-M02)

Learn more about PTMs related to Lipocalin-1 Antibody (H00003933-M02).
 

Research Areas for Lipocalin-1 Antibody (H00003933-M02)

Find related products by research area.

Blogs on Lipocalin-1

There are no specific blogs for Lipocalin-1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lipocalin-1 Antibody (1B11) and receive a gift card or discount.

Bioinformatics

Gene Symbol LCN1
Entrez
Uniprot