We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Lgr4/GPR48 Antibody

Images

 
Immunohistochemistry-Paraffin: Lgr4/GPR48 Antibody [NBP1-89737] - Staining of human breast shows strong positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related Lgr4/GPR48 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-89737
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Lgr4/GPR48 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KSHSCPALAVASCQRPEGYWSDCGTQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD
Predicted Species
Mouse (95%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LGR4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Publications
Read Publication using NBP1-89737.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lgr4/GPR48 Antibody

  • GPR48
  • GPR48G protein-coupled receptor 48
  • G-protein coupled receptor 48
  • leucine-rich repeat containing G protein-coupled receptor 4
  • Lgr4

Background

GPR48 is an Orphan-A GPCR with an unknown ligand. GPR48 expression has been documented in human brain, adrenal, heart, kidney, liver, skeletal muscle, ovary, pancreas, placenta, prostate, spleen, stomach, testis, thyroid, and spinal cord.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NLS418
Species: Hu
Applications: IHC,  IHC-P
NLS2756
Species: Hu, Pm
Applications: ICC, IHC,  IHC-P
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC,  IHC-P
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
NLS2576
Species: Hu, Pm, Rt
Applications: IHC,  IHC-P
NBP1-28904
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF1555
Species: Hu
Applications: WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
AF7388
Species: Hu
Applications: IHC
4014-SP
Species: Hu
Applications: BA
7150-RS/CF
Species: Mu
Applications: BA
NBP1-89737
Species: Hu, Mu, Rt
Applications: IHC

Publications for Lgr4/GPR48 Antibody (NBP1-89737)(1)

Reviews for Lgr4/GPR48 Antibody (NBP1-89737) (0)

There are no reviews for Lgr4/GPR48 Antibody (NBP1-89737). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Lgr4/GPR48 Antibody (NBP1-89737). (Showing 1 - 1 of 1 FAQ).

  1. May we ask why there are so many different MW expressions detected on the WB image of NBP1-89737? Can we expect to obtain GPR48 signals at approximately 104.5 KDa?
    • GPR48 protein and multi-pass transmembrane proteins in general are not easy to work with in WB assay and requires extensive optimization. This protein has several glycosylation sites and form di-sulphide multimers and can aggregate when heated during sample preparation, so that customer may see variation in observed vs expected molecular weight. We highly recommend employing Urea-gels for WB assay of this protein to deal with aggregate problems. GPR48, catalog number NBP1-89737, has been approved for Western Blot based on the band of approximately 105kD observed in RT-4 as well as U-251 MG cell lysates along with additional bands at lower position that we have not characterized yet. In our QC setting, unless required crucially, the Western blot analysis for each antibody is performed using an identical set up i.e. the same gel type and conditions are used for all antibodies and when membranes are incubated with antibodies long enough or develop the blot for a long time, there is a probability that you will see extra bands at different levels. We always show the original results achieved from lysates tested and do not remove lanes with extra bands that can not be explained with predicted target weights.

Secondary Antibodies

 

Isotype Controls

Additional Lgr4/GPR48 Products

Research Areas for Lgr4/GPR48 Antibody (NBP1-89737)

Find related products by research area.

Blogs on Lgr4/GPR48

There are no specific blogs for Lgr4/GPR48, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lgr4/GPR48 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LGR4
Entrez
Uniprot