Lgr4/GPR48 Antibody

Immunohistochemistry-Paraffin: Lgr4/GPR48 Antibody [NBP1-89737] - Staining of human breast shows strong positivity in glandular cells.

Product Discontinued

Lgr4/GPR48 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KSHSCPALAVASCQRPEGYWSDCGTQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD
• Predicted Species: Mouse (95%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LGR4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Lgr4/GPR48 Antibody

• GPR48
• GPR48G protein-coupled receptor 48
• G-protein coupled receptor 48
• leucine-rich repeat containing G protein-coupled receptor 4
• Lgr4

Background

GPR48 is an Orphan-A GPCR with an unknown ligand. GPR48 expression has been documented in human brain, adrenal, heart, kidney, liver, skeletal muscle, ovary, pancreas, placenta, prostate, spleen, stomach, testis, thyroid, and spinal cord.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Lgr4/GPR48 Antibody (NBP1-89737)(1)

Publication using NBP1-89737

• Steffen JS, Simon E, Warneke V et al. LGR4 and LGR6 are differentially expressed and of putative tumor biological significance in gastric carcinoma. Virchows Arch 2012-10-01 [PMID: 22855134]

FAQs for Lgr4/GPR48 Antibody (NBP1-89737). (Showing 1 - 1 of 1 FAQ).

1. May we ask why there are so many different MW expressions detected on the WB image of NBP1-89737? Can we expect to obtain GPR48 signals at approximately 104.5 KDa?
   • GPR48 protein and multi-pass transmembrane proteins in general are not easy to work with in WB assay and requires extensive optimization. This protein has several glycosylation sites and form di-sulphide multimers and can aggregate when heated during sample preparation, so that customer may see variation in observed vs expected molecular weight. We highly recommend employing Urea-gels for WB assay of this protein to deal with aggregate problems. GPR48, catalog number NBP1-89737, has been approved for Western Blot based on the band of approximately 105kD observed in RT-4 as well as U-251 MG cell lysates along with additional bands at lower position that we have not characterized yet. In our QC setting, unless required crucially, the Western blot analysis for each antibody is performed using an identical set up i.e. the same gel type and conditions are used for all antibodies and when membranes are incubated with antibodies long enough or develop the blot for a long time, there is a probability that you will see extra bands at different levels. We always show the original results achieved from lysates tested and do not remove lanes with extra bands that can not be explained with predicted target weights.

Bioinformatics

• Gene Symbol: LGR4
• Entrez:
  • 55366(Human)
• Uniprot:
  • Q9BXB1(Human)