![Western Blot: LEMD2 Antibody [NBP1-70599] - Human Heart lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize2/LEMD2 Antibody-Western Blot-NBP1-70599-img0002.jpg "Western Blot: LEMD2 Antibody [NBP1-70599] - Human Heart lysate, concentration 0.2-1 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptides corresponding to LEMD2(LEM domain containing 2) The peptide sequence was selected from the middle region of LEMD2.
Peptide sequence SRRRMKRVWDRAVEFLASNESRIQTESHRVAGEDMLVWRWTKPSSFSDSE. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LEMD2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This is a rabbit polyclonal antibody against LEMD2 and was validated on Western blot. |
| Theoretical MW | 57 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for LEMD2 Antibody (NBP1-70599)Discover more about diseases related to LEMD2 Antibody (NBP1-70599).
| Pathways for LEMD2 Antibody (NBP1-70599)View related products by pathway.
|
PTMs for LEMD2 Antibody (NBP1-70599)Learn more about PTMs related to LEMD2 Antibody (NBP1-70599).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LEMD2 |
![Immunocytochemistry/Immunofluorescence: BANF1 Antibody [NBP2-38442] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize2/BANF1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38442-img0004.jpg)
![Immunohistochemistry-Paraffin: BANF1 Antibody [NBP2-38442] - Staining in human fallopian tube and pancreas tissues using anti-BANF1 antibody. Corresponding BANF1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/BANF1-Antibody-Immunohistochemistry-Paraffin-NBP2-38442-img0007.jpg)
![Immunohistochemistry: BANF1 Antibody [NBP2-38442] - Staining of human cerebellum shows distinct nuclear membrane positivity in Purkinje cells.](http://images.novusbio.com/fullsize2/BANF1-Antibody-Immunohistochemistry-NBP2-38442-img0002.jpg)
![Western Blot: Emerin Antibody [NBP1-87692] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize2/Emerin-Antibody-Western-Blot-NBP1-87692-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: Emerin Antibody [NBP1-87692] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear membrane & endoplasmic reticulum.](http://images.novusbio.com/fullsize2/Emerin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87692-img0010.jpg)
![Immunohistochemistry: Emerin Antibody [NBP1-87692] - Staining of human skeletal muscle shows moderate nuclear membrane positivity in myocytes.](http://images.novusbio.com/fullsize2/Emerin-Antibody-Immunohistochemistry-NBP1-87692-img0006.jpg)
![Western Blot: LEMD3 Antibody (6C10) [NBP2-02211] Analysis of extracts (35ug) from 9 different cell lines by using anti-LEMD3 monoclonal antibody.](http://images.novusbio.com/fullsize/LEMD3 Antibody (6C10)-Western Blot-NBP2-02211-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: LEMD3 Antibody (6C10) [NBP2-02211] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY LEMD3.](http://images.novusbio.com/fullsize/LEMD3 Antibody (6C10)-Immunocytochemistry-Immunofluorescence-NBP2-02211-img0006.jpg)
![Immunohistochemistry-Paraffin: LEMD3 Antibody (6C10) [NBP2-02211] - Staining of paraffin-embedded liver tissue using anti-LEMD3mouse monoclonal antibody.](http://images.novusbio.com/fullsize/LEMD3 Antibody (6C10)-Immunohistochemistry-Paraffin-NBP2-02211-img0005.jpg)
![Western Blot: BANF2 Antibody [NBP1-88718] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/BANF2-Antibody-Western-Blot-NBP1-88718-img0003.jpg)
![Immunohistochemistry-Paraffin: BANF2 Antibody [NBP1-88718] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize2/BANF2-Antibody-Immunohistochemistry-Paraffin-NBP1-88718-img0002.jpg)
![Immunofluorescence: BANF2 Antibody [NBP1-88718] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.](http://images.novusbio.com/fullsize2/BANF2-Antibody-Immunofluorescence-NBP1-88718-img0004.jpg)
![Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.](http://images.novusbio.com/fullsize2/ERK1-Antibody-(1E5)-Western-Blot-NBP2-22203-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.](http://images.novusbio.com/fullsize2/ERK1-Antibody-(1E5)-Immunocytochemistry-Immunofluorescence-NBP2-22203-img0002.jpg)
![Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.](http://images.novusbio.com/fullsize2/ERK1-Antibody-(1E5)-Immunohistochemistry-Paraffin-NBP2-22203-img0004.jpg)
![Western Blot: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - Analysis of human bone marrow tissue lysate with 0.5 ug/ml of hELA-2 Monoclonal Antibody followed by HRP-conjugated Anti-Rabbit IgG Antibody. A specific band was detected for hELA-2 at approximately 25-30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.](http://images.novusbio.com/fullsize2/Neutrophil-Elastase-ELA2-Antibody-(950334)-Western-Blot-MAB9167-img0001.jpg)
![Immunocytochemistry: Neutrophil Elastase/ELA2 Antibody (950334) - Azide Free [MAB9167] - Neutrophil Elastase/ELA2 was detected in immersion fixed THP-1 cell using Neutrophil Elastase/ELA2 Monoclonal Antibody at 8 ug/ml dilution. Cells were stained using Donkey anti-Mouse IgG Secondary Antibody [NL557] (red) and counterstained with DAPI (blue). Specific staining was localized to cytoplasmic.](http://images.novusbio.com/fullsize2/Neutrophil-Elastase-ELA2-Antibody-(950334)---Azide-Free-Immunocytochemistry-MAB9167-img0006.jpg)
![Immunohistochemistry: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - ELA-2 was detected in immersion fixed paraffin-embedded sections of human lymphoma using ELA-2 Monoclonal Antibody at 5 ug/ml. Tissue was stained using Mouse IgG VisUCyte HRP Polymer Antibody (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neutrophils.](http://images.novusbio.com/fullsize2/Neutrophil-Elastase-ELA2-Antibody-(950334)-Immunohistochemistry-MAB9167-img0002.jpg)
![Western Blot: Musculin Antibody [NBP2-56244] - Western blot analysis in human cell line RT-4.](http://images.novusbio.com/fullsize2/Musculin Antibody-Western Blot-NBP2-56244-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Musculin Antibody [NBP2-56244] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize2/Musculin-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56244-img0001.jpg)
![Western Blot: Lamin B Receptor Antibody [H00003930-B01P] - Analysis of LBR expression in transfected 293T cell line by LBR polyclonal antibody. Lane 1: LBR transfected lysate(67.65 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize2/Lamin B Receptor Antibody-Western Blot-H00003930-B01P-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: Lamin B Receptor Antibody [H00003930-B01P] - Analysis of purified antibody to LBR on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize2/Lamin-B-Receptor-Antibody-Immunocytochemistry-Immunofluorescence-H00003930-B01P-img0005.jpg)
![Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [H00003930-B01P] - Analysis of purified antibody to LBR on formalin-fixed paraffin-embedded human small Intestine. (antibody concentration 3 ug/ml)](http://images.novusbio.com/fullsize2/Lamin-B-Receptor-Antibody-Immunohistochemistry-Paraffin-H00003930-B01P-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: Lamin C Antibody (EM-11) [NBP1-50051] - Staining of lamin C (green) in mouse EL-6 fibroblasts by monoclonal antibody EM-11. DNA stained by DAPI (blue).](http://images.novusbio.com/fullsize2/Lamin-C-Antibody-(EM-11)-Immunocytochemistry-NBP1-50051-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: Lamin C Antibody (EM-11) [NBP1-50051] - Staining of lamin C (red) in HeLa cells by monoclonal antibody EM-11. Actin decorated by phalloidin-Alexa Fluor(R) 488 (green), DNA stained by DAPI (blue).](http://images.novusbio.com/fullsize2/Lamin-C-Antibody-(EM-11)-Immunocytochemistry-NBP1-50051-img0006.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0005.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.")