Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.
Reactivity | HuSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Synthetic peptides corresponding to LEMD2(LEM domain containing 2) The peptide sequence was selected from the middle region of LEMD2. Peptide sequence SRRRMKRVWDRAVEFLASNESRIQTESHRVAGEDMLVWRWTKPSSFSDSE. The peptide sequence for this immunogen was taken from within the described region. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | LEMD2 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | This is a rabbit polyclonal antibody against LEMD2 and was validated on Western blot. |
Theoretical MW | 57 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for LEMD2 Antibody (NBP1-70599)Discover more about diseases related to LEMD2 Antibody (NBP1-70599).
| Pathways for LEMD2 Antibody (NBP1-70599)View related products by pathway.
|
PTMs for LEMD2 Antibody (NBP1-70599)Learn more about PTMs related to LEMD2 Antibody (NBP1-70599).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | LEMD2 |