Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.
![Western Blot: LEMD2 Antibody [NBP1-70599] - Human Heart lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize2/LEMD2-Antibody-Western-Blot-NBP1-70599-img0002.jpg "Western Blot: LEMD2 Antibody [NBP1-70599] - Human Heart lysate, concentration 0.2-1 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptides corresponding to LEMD2(LEM domain containing 2) The peptide sequence was selected from the middle region of LEMD2. Peptide sequence SRRRMKRVWDRAVEFLASNESRIQTESHRVAGEDMLVWRWTKPSSFSDSE. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LEMD2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This is a rabbit polyclonal antibody against LEMD2 and was validated on Western blot. |
| Theoretical MW | 57 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
![Flow Cytometry: LEMD3 Antibody (OTI6C10) [NBP2-02211] - Analysis of Hela cells, using anti-LEMD3 antibody, (Red) compared to a nonspecific negative control antibody (Blue).](http://images.novusbio.com/images2/LEMD3-Antibody-(OTI6C10)-Flow-Cytometry-NBP2-02211-img0001.jpg)
![Flow Cytometry: LEMD3 Antibody (OTI6C10) [NBP2-02211] - Analysis of Jurkat cells, using anti-LEMD3 antibody, (Red) compared to a nonspecific negative control antibody (Blue).](http://images.novusbio.com/images2/LEMD3-Antibody-(OTI6C10)-Flow-Cytometry-NBP2-02211-img0002.jpg)
![Western Blot: LEMD3 Antibody (OTI6C10) [NBP2-02211] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY LEMD3 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-LEMD3.](http://images.novusbio.com/images2/LEMD3-Antibody-(OTI6C10)-Western-Blot-NBP2-02211-img0003.jpg)
![Immunohistochemistry-Paraffin: BANF2 Antibody [NBP1-88718] - Staining of human testis shows moderate nuclear positivity in spermatids.](http://images.novusbio.com/images2/BANF2-Antibody-Immunohistochemistry-Paraffin-NBP1-88718-img0006.jpg)
![Western Blot: BANF2 Antibody [NBP1-88718] - Analysis in control (vector only transfected HEK293T lysate) and BANF2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/BANF2-Antibody-Western-Blot-NBP1-88718-img0005.jpg)
![Immunohistochemistry-Paraffin: BANF2 Antibody [NBP1-88718] - Staining of human pancreas shows weak cytoplasmic and nuclear positivity in islets of Langerhans.](http://images.novusbio.com/images2/BANF2-Antibody-Immunohistochemistry-Paraffin-NBP1-88718-img0007.jpg)
![Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).](http://images.novusbio.com/images2/ERK1-Antibody-(1E5)-Flow-Cytometry-NBP2-22203-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.](http://images.novusbio.com/images2/ERK1-Antibody-(1E5)-Immunocytochemistry-Immunofluorescence-NBP2-22203-img0002.jpg)
![Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.](http://images.novusbio.com/images2/ERK1-Antibody-(1E5)-Immunohistochemistry-Paraffin-NBP2-22203-img0003.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for LEMD2 Antibody (NBP1-70599)Discover more about diseases related to LEMD2 Antibody (NBP1-70599).
| Pathways for LEMD2 Antibody (NBP1-70599)View related products by pathway.
|
PTMs for LEMD2 Antibody (NBP1-70599)Learn more about PTMs related to LEMD2 Antibody (NBP1-70599).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LEMD2 |
![Immunohistochemistry-Paraffin: BANF1 Antibody (3F10-4G12) [H00008815-M01] - Analysis of monoclonal antibody to BANF1 on formalin-fixed paraffin-embedded human esophagus. Antibody concentration 3 ug/ml.](http://images.novusbio.com/images2/BANF1-Antibody-(3F10-4G12)-Immunohistochemistry-Paraffin-H00008815-M01-img0005.jpg)
![Western Blot: BANF1 Antibody (3F10-4G12) [H00008815-M01] - BANF1 monoclonal antibody (M01), clone 3F10-4G12 Analysis of BANF1 expression in Jurkat.](http://images.novusbio.com/images2/BANF1-Antibody-(3F10-4G12)-Western-Blot-H00008815-M01-img0007.jpg)
![Sandwich ELISA: BANF1 Antibody (3F10-4G12) [H00008815-M01] - Detection limit for recombinant GST tagged BANF1 is approximately 1ng/ml as a capture antibody.](http://images.novusbio.com/images2/BANF1-Antibody-(3F10-4G12)-Sandwich-ELISA-H00008815-M01-img0006.jpg)
![Immunohistochemistry-Paraffin: Emerin Antibody [NBP1-87692] - Staining of human skeletal muscle shows moderate nuclear membrane positivity in myocytes.](http://images.novusbio.com/images2/Emerin-Antibody-Immunohistochemistry-Paraffin-NBP1-87692-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: Emerin Antibody [NBP1-87692] - Staining of human cell line U-251 MG shows localization to nuclear membrane & endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/images2/Emerin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87692-img0010.jpg)
![Western Blot: Emerin Antibody [NBP1-87692] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.](http://images.novusbio.com/images2/Emerin-Antibody-Western-Blot-NBP1-87692-img0011.jpg)
![Western Blot: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - Analysis of human bone marrow tissue lysate with 0.5 ug/ml of hELA-2 Monoclonal Antibody followed by HRP-conjugated Anti-Rabbit IgG Antibody. A specific band was detected for hELA-2 at approximately 25-30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.](http://images.novusbio.com/images2/Neutrophil-Elastase-ELA2-Antibody-(950334)-Western-Blot-MAB9167-img0001.jpg)
![Immunohistochemistry: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - ELA-2 was detected in immersion fixed paraffin-embedded sections of human lymphoma using ELA-2 Monoclonal Antibody at 5 ug/ml. Tissue was stained using Mouse IgG VisUCyte HRP Polymer Antibody (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neutrophils .](http://images.novusbio.com/images2/Neutrophil-Elastase-ELA2-Antibody-(950334)-Immunohistochemistry-MAB9167-img0002.jpg)
![Flow Cytometry: Neutrophil Elastase/ELA2 Antibody (950334) - Azide Free [MAB9167] - THP-1 human acute monocytic leukemia cell line treated with 3 uM monensin for 3 hours was stained with Mouse Anti-Human Neutrophil Elastase/ELA2 Monoclonal Antibody (Catalog # MAB9167, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005).](http://images.novusbio.com/images2/Neutrophil-Elastase-ELA2-Antibody-(950334)---Azide-Free-Flow-Cytometry-MAB9167-img0005.jpg)
![Western Blot: Musculin Antibody (1D1) [H00009242-M01] - Detection against Immunogen (35.2 KDa) .](http://images.novusbio.com/images2/Musculin-Antibody-(1D1)-Western-Blot-H00009242-M01-img0001.jpg)
![Western Blot: Lamin B Receptor Antibody [H00003930-B01P] - Expression in Jurkat.](http://images.novusbio.com/images2/Lamin-B-Receptor-Antibody-Western-Blot-H00003930-B01P-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: Lamin B Receptor Antibody [H00003930-B01P] - Analysis of purified antibody to LBR on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/images2/Lamin-B-Receptor-Antibody-Immunocytochemistry-Immunofluorescence-H00003930-B01P-img0005.jpg)
![Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [H00003930-B01P] - Analysis of purified antibody to LBR on formalin-fixed paraffin-embedded human small Intestine. (antibody concentration 3 ug/ml)](http://images.novusbio.com/images2/Lamin-B-Receptor-Antibody-Immunohistochemistry-Paraffin-H00003930-B01P-img0006.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](http://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")