LEMD2 Antibody


Western Blot: LEMD2 Antibody [NBP1-70598] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

LEMD2 Antibody Summary

Synthetic peptides corresponding to LEMD2(LEM domain containing 2) The peptide sequence was selected from the middle region of LEMD2. Peptide sequence QDMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESH.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LEMD2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LEMD2 Antibody

  • LEM domain containing 2


LEMD2 is involved in nuclear structure organization.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IF
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IP

Publications for LEMD2 Antibody (NBP1-70598) (0)

There are no publications for LEMD2 Antibody (NBP1-70598).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LEMD2 Antibody (NBP1-70598) (0)

There are no reviews for LEMD2 Antibody (NBP1-70598). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LEMD2 Antibody (NBP1-70598) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional LEMD2 Products

Bioinformatics Tool for LEMD2 Antibody (NBP1-70598)

Discover related pathways, diseases and genes to LEMD2 Antibody (NBP1-70598). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LEMD2 Antibody (NBP1-70598)

Discover more about diseases related to LEMD2 Antibody (NBP1-70598).

Pathways for LEMD2 Antibody (NBP1-70598)

View related products by pathway.

PTMs for LEMD2 Antibody (NBP1-70598)

Learn more about PTMs related to LEMD2 Antibody (NBP1-70598).

Blogs on LEMD2

There are no specific blogs for LEMD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LEMD2 Antibody and receive a gift card or discount.


Gene Symbol LEMD2