LEMD2 Antibody

Images

 
Western Blot: LEMD2 Antibody [NBP1-70598] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

LEMD2 Antibody Summary

Immunogen
Synthetic peptides corresponding to LEMD2(LEM domain containing 2) The peptide sequence was selected from the middle region of LEMD2. Peptide sequence QDMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESH.
Clonality
Polyclonal
Host
Rabbit
Gene
LEMD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LEMD2 and was validated on Western blot.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LEMD2 Antibody

  • LEM domain containing 2

Background

LEMD2 is involved in nuclear structure organization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76751
Species: Hu, Mu, Rt, Ha
Applications: WB, ELISA, ICC/IF
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02211
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88718
Species: Hu
Applications: WB, IHC, IHC-P, IF
MAB18251
Species: Hu, Mu
Applications: WB, Simple Western
NB100-92290
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00003930-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-50051
Species: Hu, Mu
Applications: WB, ICC/IF, IP

Publications for LEMD2 Antibody (NBP1-70598) (0)

There are no publications for LEMD2 Antibody (NBP1-70598).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LEMD2 Antibody (NBP1-70598) (0)

There are no reviews for LEMD2 Antibody (NBP1-70598). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LEMD2 Antibody (NBP1-70598) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LEMD2 Antibody Products

Related Products by Gene

Bioinformatics Tool for LEMD2 Antibody (NBP1-70598)

Discover related pathways, diseases and genes to LEMD2 Antibody (NBP1-70598). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LEMD2 Antibody (NBP1-70598)

Discover more about diseases related to LEMD2 Antibody (NBP1-70598).
 

Pathways for LEMD2 Antibody (NBP1-70598)

View related products by pathway.

PTMs for LEMD2 Antibody (NBP1-70598)

Learn more about PTMs related to LEMD2 Antibody (NBP1-70598).

Blogs on LEMD2

There are no specific blogs for LEMD2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol LEMD2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-70598 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought