![Western Blot: LARS Antibody [NBP2-38478] - Analysis in human cell line SK-MEL-30.](http://images.novusbio.com/fullsize/LARS-Antibody-Western-Blot-NBP2-38478-img0007.jpg "Western Blot: LARS Antibody [NBP2-38478] - Analysis in human cell line SK-MEL-30.")
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KWDTERVFEVNASNLEKQTSKGKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRLKGKCCLFPFGLHCTGMPIKACADKLK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LARS |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: LARS Antibody [NBP2-38478] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies & cytosol.](http://images.novusbio.com/fullsize/LARS-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38478-img0005.jpg "Immunocytochemistry/Immunofluorescence: LARS Antibody [NBP2-38478] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies & cytosol.")
![Immunohistochemistry-Paraffin: LARS Antibody [NBP2-38478] - Staining of human liver shows no cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/LARS-Antibody-Immunohistochemistry-Paraffin-NBP2-38478-img0011.jpg "Immunohistochemistry-Paraffin: LARS Antibody [NBP2-38478] - Staining of human liver shows no cytoplasmic positivity in hepatocytes.")
![Western Blot: LARS Antibody [NBP2-38478] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG](http://images.novusbio.com/fullsize/LARS-Antibody-Western-Blot-NBP2-38478-img0003.jpg "Western Blot: LARS Antibody [NBP2-38478] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG")
![Immunohistochemistry-Paraffin: LARS Antibody [NBP2-38478] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.](http://images.novusbio.com/fullsize/LARS-Antibody-Immunohistochemistry-Paraffin-NBP2-38478-img0006.jpg "Immunohistochemistry-Paraffin: LARS Antibody [NBP2-38478] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.")
![Immunohistochemistry-Paraffin: LARS Antibody [NBP2-38478] - Analysis in human cerebral cortex and liver tissues using NBP2-38478 antibody. Corresponding LARS RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/LARS-Antibody-Immunohistochemistry-Paraffin-NBP2-38478-img0008.jpg "Immunohistochemistry-Paraffin: LARS Antibody [NBP2-38478] - Analysis in human cerebral cortex and liver tissues using NBP2-38478 antibody. Corresponding LARS RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: LARS Antibody [NBP2-38478] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/LARS-Antibody-Immunohistochemistry-Paraffin-NBP2-38478-img0009.jpg "Immunohistochemistry-Paraffin: LARS Antibody [NBP2-38478] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: LARS Antibody [NBP2-38478] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/LARS-Antibody-Immunohistochemistry-Paraffin-NBP2-38478-img0010.jpg "Immunohistochemistry-Paraffin: LARS Antibody [NBP2-38478] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: LARS Antibody [NBP2-38478] - Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/LARS-Antibody-Immunohistochemistry-Paraffin-NBP2-38478-img0012.jpg "Immunohistochemistry-Paraffin: LARS Antibody [NBP2-38478] - Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.")
![Knockout Validated Calcitonin R Antibody (462802) [Unconjugated]](https://images.novusbio.com/images2/Calcitonin_R_MAB4614_Knockout_Validated_23018.jpg)
![Flow Cytometry Calcitonin R Antibody (462802) [Unconjugated]](https://images.novusbio.com/images2/Calcitonin_R_MAB4614_Flow_Cytometry_8474.jpg)
![Immunocytochemistry/ Immunofluorescence Calcitonin R Antibody (462802) [Unconjugated]](https://images.novusbio.com/images/mab4614_human-calcitonin-r-mab-clone-462802-41202410484315.jpg)
![Immunohistochemistry Desmin Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmin_AF3844_Immunohistochemistry_10689.jpg)
![Immunohistochemistry Desmin Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmin_AF3844_Immunohistochemistry_6808.jpg)
![Immunocytochemistry/ Immunofluorescence Desmin Antibody [Unconjugated]](https://images.novusbio.com/images/af3844_human-mouse-desmin-affinity-purified-polyclonal-ab-41202410331920.jpg)
