We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human LARP2 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human LARP2 Protein [H00055132-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human LARP2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-201 of Human LARP2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDSRDHGPGTSSVSTSNASPSEGAPLAGSYGCTPHSFPKFQHPSHELLKENGFTQQVYHKYRRRCLSERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFRQLAWEDAKENYRYGLECLFRFYSYGLEKKFRREIFQDFQEETKKDYESGQLYGLEKFWAYLKYSQSKTQSIDPKLQEYLCSFKRLEDFRVDEADPIE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
LARP1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
50.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LARP2 GST (N-Term) Protein

  • DKFZp434K245
  • DKFZp686E0316
  • DKFZp686L13217
  • FLJ10378
  • La ribonucleoprotein domain family member 1B
  • La ribonucleoprotein domain family member 2
  • La ribonucleoprotein domain family, member 1B
  • La ribonucleoprotein domain family, member 2
  • la-related protein 1B
  • La-related protein 2
  • LARP2
  • MGC117277
  • MGC75174

Background

This gene encodes a protein containing domains found in the La related protein of Drosophila melanogaster. La motif-containing proteins are thought to be RNA-binding proteins, where the La motif and adjacent amino acids fold into an RNA recognition motif. The La motif is also found in proteins unrelated to the La protein. Alternative splicing has been observed at this locus and three variants, encoding distinct isoforms, are described. Additional splice variation has been identified but the full-length nature of these transcripts has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-704
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-75734
Species: Hu
Applications: ELISA, IHC,  IHC-P, PA, WB
NBP2-21584
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-18715
Species: Hu
Applications: ELISA, S-ELISA
NBP1-87154
Species: Hu
Applications: COMET, ICC/IF, IHC,  IHC-P, KD, mIF, WB
NBP1-48002
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-32733
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
DTM100
Species: Hu
Applications: ELISA
MEP00B
Species: Mu
Applications: ELISA
NBP1-51684
Species: Hu, Mu
Applications: EM, ELISA, Flow, ICC/IF, IHC, WB
MAB6547
Species: Hu
Applications: Flow, IHC, mIF
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB

Publications for LARP2 Recombinant Protein (H00055132-P01) (0)

There are no publications for LARP2 Recombinant Protein (H00055132-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LARP2 Recombinant Protein (H00055132-P01) (0)

There are no reviews for LARP2 Recombinant Protein (H00055132-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LARP2 Recombinant Protein (H00055132-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LARP2 Products

Array H00055132-P01

Research Areas for LARP2 Recombinant Protein (H00055132-P01)

Find related products by research area.

Blogs on LARP2

There are no specific blogs for LARP2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LARP2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LARP1B