LAMTOR4 Antibody - BSA Free

Western Blot: LAMTOR4 Antibody [NBP1-90936] - Analysis in human cell line MCF-7.

Immunocytochemistry/Immunofluorescence: LAMTOR4 Antibody [NBP1-90936] - C7orf59 Antibody [NBP1-90936] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: LAMTOR4 Antibody [NBP1-90936] - C7orf59 Antibody [NBP1-90936] - Staining in human lymph node and pancreas tissues using anti-LAMTOR4 antibody. Corresponding LAMTOR4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: LAMTOR4 Antibody [NBP1-90936] - Staining of human lymph node shows high expression.

Immunohistochemistry-Paraffin: LAMTOR4 Antibody [NBP1-90936] - Staining of human pancreas shows low expression as expected.

Staining of human liver shows no positivity in hepatocytes as expected.

Analysis in human skin and liver tissues using NBP1-90936 antibody. Corresponding LAMTOR4 RNA-seq data are presented for the same tissues.

Staining of human skin shows strong granular cytoplasmic positivity in squamous epithelial cells.

Staining of human lymph node shows strong granular cytoplasmic positivity in germinal and non-germinal center cells.

Analysis in human cell line MCF-7.

Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LAMTOR4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LAMTOR4 Antibody - BSA Free (NBP1-90936) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LAMTOR4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LAMTOR4 Recombinant Protein Antigen (NBP1-90936PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LAMTOR4 Antibody - BSA Free

• C7orf59
• chromosome 7 open reading frame 59
• hypothetical protein LOC389541
• late endosomal/lysosomal adaptor, MAPK and MTOR activator 4
• MGC163425
• MGC163431

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LAMTOR4