HBXIP Antibody (4G1) - Azide and BSA Free

Western Blot: HBXIP Antibody (4G1) [H00010542-M12] - Analysis of HBXIP expression in MCF-7.

Immunocytochemistry/Immunofluorescence: HBXIP Antibody (4G1) [H00010542-M12] - Analysis of monoclonal antibody to HBXIP on HeLa cell. Antibody concentration 10 ug/ml

Western Blot: HBXIP Antibody (4G1) [H00010542-M12] - Analysis of HBXIP expression in A-431.

Western Blot: HBXIP Antibody (4G1) [H00010542-M12] - Analysis of HBXIP expression in Jurkat.

Western Blot: HBXIP Antibody (4G1) [H00010542-M12] - Analysis of HBXIP expression in transfected 293T cell line by HBXIP monoclonal antibody (M12), clone 4G1. Lane 1: HBXIP transfected lysatE (10.12 KDa). Lane 2: Non-transfected lysate.

Sandwich ELISA: HBXIP Antibody (4G1) [H00010542-M12] - Detection limit for recombinant GST tagged HBXIP is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 4G1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HBXIP Antibody (4G1) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse HBXIP Antibody (4G1) - Azide and BSA Free (H00010542-M12) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: HBXIP (AAH62619, 83 a.a. ~ 173 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAAHKMAS
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: LAMTOR5
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is useful for ELISA, Western Blot

Reactivity Notes

This product is reactive against Human.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HBXIP Antibody (4G1) - Azide and BSA Free

• HBV X-interacting protein
• HBX-interacting protein
• hepatitis B virus x interacting protein
• hepatitis B virus x-interacting protein (9.6kD)
• MGC71071
• XIPhepatitis B virus X-interacting protein

Background

This gene encodes a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LAMTOR5
• Uniprot:
  • AAH62619(Human)