L3MBTL1 Antibody - BSA Free

Western Blot: L3MBTL1 Antibody [NBP3-10451] - Western blot analysis using NBP3-10451 on Mouse Small Intestine as a positive control. Antibody Titration: 0.2-1 ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

L3MBTL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit L3MBTL1 Antibody - BSA Free (NBP3-10451) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human L3MBTL1 (XP_900202). Peptide sequence LKPMKKRKHKEYQSPSEESEPEAVKQGEGKDAEREPTPSTPENEEWSRSQ
• Clonality: Polyclonal
• Host: Rabbit
• Gene: L3MBTL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 91 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for L3MBTL1 Antibody - BSA Free

• dJ138B7.3
• FLJ41181
• H-l(3)mbt protein
• H-L(3)MBT
• KIAA0681L3MBTLDKFZp586P1522
• l(3)mbt (Drosophila)-like
• L(3)mbt protein homolog
• l(3)mbt-like (Drosophila)
• l(3)mbt-like 1 (Drosophila)
• L(3)mbt-like
• L3MBT
• lethal (3) malignant brain tumor l(3)
• lethal(3)malignant brain tumor-like protein

Background

L3MBTL1 encodes the homolog of a protein identified in Drosophila as a suppressor of malignant transformation of neuroblasts and ganglion-mother cells in the optic centers of the brain. This gene product is localized to condensed chromosomes in mitotic cells. Overexpression of this gene in a glioma cell line results in improper nuclear segregation and cytokinesis producing multinucleated cells. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: L3MBTL1