KvBeta3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: KvBeta3 Antibody [NBP2-58857] - Staining of human cell line U-2 OS shows localization to mitochondria.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KvBeta3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KvBeta3 Antibody - BSA Free (NBP2-58857) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('CGLITSKYDGRVPDTCRASIKGYQWLKDKVQSEDGKKQQAKVMDLLPVAHQ',)
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNAB3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  KvBeta3 Recombinant Protein Antigen (NBP2-58857PEP)

Reactivity Notes

Mouse 84%, Rat 80%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KvBeta3 Antibody - BSA Free

• AKR6A9
• K(+) channel subunit beta-3
• KCNA3.1B
• KCNA3BK+ channel beta-3 subunit
• Kv-beta-3
• MGC116886
• potassium channel, voltage-dependent, beta-3 subunit
• potassium voltage-gated channel, shaker-related subfamily, beta member 3
• voltage-gated potassium channel subunit beta-3

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member and the KCNA5 gene product assemble into a heteromultimeric A-type channel that inactivates completely and is significantly faster than other A-type Kv channels. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNAB3