We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Kv8.1 Recombinant Protein Antigen

Images

 
There are currently no images for Kv8.1 Recombinant Protein Antigen (NBP3-24949PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Kv8.1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Kv8.1

Source: E.coli

Amino Acid Sequence: LCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDFKKDTEDQESQHESEQDFSQGPCPTVRQKLWNILEK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNV1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24949It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kv8.1 Recombinant Protein Antigen

  • HNKA
  • KCNB3
  • KV2.3
  • KV8.1
  • Neuronal potassium channel alpha subunit HNKA
  • potassium channel Kv8.1
  • potassium channel, subfamily V, member 1
  • potassium voltage-gated channel subfamily V member 1
  • Voltage-gated potassium channel subunit Kv8.1

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium voltage-gated channel subfamily V. This protein is essentially present in the brain, and its role might be to inhibit the function of a particular class of outward rectifier potassium channel types. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38498
Species: Hu
Applications: IHC,  IHC-P
NB300-279
Species: Ha, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-85189
Species: Hu
Applications: IHC,  IHC-P, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
AF838
Species: Hu
Applications: AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, Simple Western, WB
DPSG10
Species: Hu
Applications: ELISA
NB300-261
Species: Rt, Xp
Applications: IHC, IHC-Fr, WB
3047-CC
Species: Hu
Applications: BA
NBP3-03307
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00054716-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
7268-CT
Species: Hu
Applications: BA
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-12904
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, MiAr, WB
AF2727
Species: Hu
Applications: ICC, Simple Western, WB

Publications for Kv8.1 Recombinant Protein Antigen (NBP3-24949PEP) (0)

There are no publications for Kv8.1 Recombinant Protein Antigen (NBP3-24949PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv8.1 Recombinant Protein Antigen (NBP3-24949PEP) (0)

There are no reviews for Kv8.1 Recombinant Protein Antigen (NBP3-24949PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kv8.1 Recombinant Protein Antigen (NBP3-24949PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kv8.1 Products

Research Areas for Kv8.1 Recombinant Protein Antigen (NBP3-24949PEP)

Find related products by research area.

Blogs on Kv8.1

There are no specific blogs for Kv8.1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kv8.1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNV1