Recombinant Human Kv8.1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Kv8.1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 26-124 of Human Kv8.1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: FCSEGEGEPLALGDCFTVNVGGSRFVLSQQALSCFPHTRLGKLAVVVASYRRPGALAAVPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYYRTGRLHV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
KCNV1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Kv8.1 GST (N-Term) Protein

  • HNKA
  • KCNB3
  • KV2.3
  • KV8.1
  • Neuronal potassium channel alpha subunit HNKA
  • potassium channel Kv8.1
  • potassium channel, subfamily V, member 1
  • potassium voltage-gated channel subfamily V member 1
  • Voltage-gated potassium channel subunit Kv8.1

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium voltage-gated channel subfamily V. This protein is essentially present in the brain, and its role might be to inhibit the function of a particular class of outward rectifier potassium channel types. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38498
Species: Hu
Applications: IHC, IHC-P
NBP1-42819
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, IP, B/N
NBP1-42788
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, IP
NBP1-47609
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
AF838
Species: Hu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
DPSG10
Species: Hu
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP3-03307
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-12904
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF2727
Species: Hu
Applications: WB, Simple Western, ICC

Publications for Kv8.1 Partial Recombinant Protein (H00027012-Q01) (0)

There are no publications for Kv8.1 Partial Recombinant Protein (H00027012-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv8.1 Partial Recombinant Protein (H00027012-Q01) (0)

There are no reviews for Kv8.1 Partial Recombinant Protein (H00027012-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv8.1 Partial Recombinant Protein (H00027012-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Kv8.1 Products

Bioinformatics Tool for Kv8.1 Partial Recombinant Protein (H00027012-Q01)

Discover related pathways, diseases and genes to Kv8.1 Partial Recombinant Protein (H00027012-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv8.1 Partial Recombinant Protein (H00027012-Q01)

Discover more about diseases related to Kv8.1 Partial Recombinant Protein (H00027012-Q01).
 

Pathways for Kv8.1 Partial Recombinant Protein (H00027012-Q01)

View related products by pathway.

PTMs for Kv8.1 Partial Recombinant Protein (H00027012-Q01)

Learn more about PTMs related to Kv8.1 Partial Recombinant Protein (H00027012-Q01).

Blogs on Kv8.1

There are no specific blogs for Kv8.1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Kv8.1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNV1