Recombinant Human Kv8.1 GST (N-Term) Protein Summary
Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 26-124 of Human Kv8.1 Source: Wheat Germ (in vitro) Amino Acid Sequence: FCSEGEGEPLALGDCFTVNVGGSRFVLSQQALSCFPHTRLGKLAVVVASYRRPGALAAVPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYYRTGRLHV |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source |
Wheat germ |
Protein/Peptide Type |
Partial Recombinant Protein |
Gene |
KCNV1 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Theoretical MW |
36.63 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -80C. Avoid freeze-thaw cycles. |
Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Kv8.1 GST (N-Term) Protein
Background
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium voltage-gated channel subfamily V. This protein is essentially present in the brain, and its role might be to inhibit the function of a particular class of outward rectifier potassium channel types. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, IP, B/N
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
Species: Hu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, Simple Western, ICC
Publications for Kv8.1 Partial Recombinant Protein (H00027012-Q01) (0)
There are no publications for Kv8.1 Partial Recombinant Protein (H00027012-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Kv8.1 Partial Recombinant Protein (H00027012-Q01) (0)
There are no reviews for Kv8.1 Partial Recombinant Protein (H00027012-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Kv8.1 Partial Recombinant Protein (H00027012-Q01) (0)
Other Available Formats
Additional Kv8.1 Products
Bioinformatics Tool for Kv8.1 Partial Recombinant Protein (H00027012-Q01)
Discover related pathways, diseases and genes to Kv8.1 Partial Recombinant Protein (H00027012-Q01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Kv8.1 Partial Recombinant Protein (H00027012-Q01)
Discover more about diseases related to Kv8.1 Partial Recombinant Protein (H00027012-Q01).
| | Pathways for Kv8.1 Partial Recombinant Protein (H00027012-Q01)
View related products by pathway.
|
PTMs for Kv8.1 Partial Recombinant Protein (H00027012-Q01)
Learn more about PTMs related to Kv8.1 Partial Recombinant Protein (H00027012-Q01).
|
Blogs on Kv8.1