We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Kv1.6 Recombinant Protein Antigen

Images

 
There are currently no images for Kv1.6 Recombinant Protein Antigen (NBP3-24946PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Kv1.6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Kv1.6

Source: E.coli

Amino Acid Sequence: EQGQYTHVTCGQPAPDLRATDNGLGKPDFPEANRERRPSYLPTPHRAYAE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNA6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24946It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kv1.6 Recombinant Protein Antigen

  • FLJ25134
  • HBK2
  • human brain potassium channel-2
  • KCNA6
  • Kv1.6
  • potassium voltage-gated channel subfamily A member 6
  • potassium voltage-gated channel, shaker-related subfamily, member 6
  • Voltage-gated potassium channel HBK2
  • voltage-gated potassium channel protein Kv1.6
  • Voltage-gated potassium channel subunit Kv1.6

Background

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homologs. This protein is a member of the potassium channel, voltage-gated, shaker-related subfamily. Kv1.6 contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class. The coding region of this gene is intronless, and the gene is clustered with genes KCNA1 and KCNA5 on chromosome 12. Kv1.6 is a homologue of the Drosophila gene Shaker, which is involved in reduced sleep and life expectancy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-03729
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP3-46349
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP3-46347
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-48533
Species: Hu
Applications: IHC,  IHC-P
NBP2-76939
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-38498
Species: Hu
Applications: IHC,  IHC-P
NBP3-03748
Species: Mu
Applications: IHC,  IHC-P, WB
NBP2-85189
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-03750
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB300-279
Species: Ha, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP3-52279
Species: Mu
Applications: WB
NBP3-03744
Species: Hu, Mu, Rt
Applications: WB
NB300-261
Species: Rt, Xp
Applications: IHC, IHC-Fr, WB
NBP2-20119
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP3-03109
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NBP1-81572
Species: Hu, Mu, Rt
Applications: ICC/IF,  IHC-P, WB
NBP2-62639
Species: Hu
Applications: IHC,  IHC-P
H00003753-M01
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP3-24946PEP
Species: Hu
Applications: AC

Publications for Kv1.6 Recombinant Protein Antigen (NBP3-24946PEP) (0)

There are no publications for Kv1.6 Recombinant Protein Antigen (NBP3-24946PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv1.6 Recombinant Protein Antigen (NBP3-24946PEP) (0)

There are no reviews for Kv1.6 Recombinant Protein Antigen (NBP3-24946PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kv1.6 Recombinant Protein Antigen (NBP3-24946PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kv1.6 Products

Array NBP3-24946PEP

Research Areas for Kv1.6 Recombinant Protein Antigen (NBP3-24946PEP)

Find related products by research area.

Blogs on Kv1.6

There are no specific blogs for Kv1.6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kv1.6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNA6