Kv1.6 Antibody


Immunohistochemistry-Paraffin: Kv1.6 Antibody [NBP1-89717] - Staining of human pancreas shows moderate cytoplasmic positivity.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Kv1.6 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GRGGNNGGVSRVSPVSRGSQEEEEDEDDSYTFHHGITPGEMGTG
Specificity of human Kv1.6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kv1.6 Protein (NBP1-89717PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Kv1.6 Antibody

  • FLJ25134
  • HBK2
  • human brain potassium channel-2
  • KV1.6
  • potassium voltage-gated channel subfamily A member 6
  • potassium voltage-gated channel, shaker-related subfamily, member 6
  • Voltage-gated potassium channel HBK2
  • voltage-gated potassium channel protein Kv1.6
  • Voltage-gated potassium channel subunit Kv1.6


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, B/N, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, RNAi

Publications for Kv1.6 Antibody (NBP1-89717) (0)

There are no publications for Kv1.6 Antibody (NBP1-89717).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv1.6 Antibody (NBP1-89717) (0)

There are no reviews for Kv1.6 Antibody (NBP1-89717). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Kv1.6 Antibody (NBP1-89717) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Kv1.6 Products

Bioinformatics Tool for Kv1.6 Antibody (NBP1-89717)

Discover related pathways, diseases and genes to Kv1.6 Antibody (NBP1-89717). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv1.6 Antibody (NBP1-89717)

Discover more about diseases related to Kv1.6 Antibody (NBP1-89717).

Pathways for Kv1.6 Antibody (NBP1-89717)

View related products by pathway.

PTMs for Kv1.6 Antibody (NBP1-89717)

Learn more about PTMs related to Kv1.6 Antibody (NBP1-89717).

Blogs on Kv1.6

There are no specific blogs for Kv1.6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Kv1.6 Antibody and receive a gift card or discount.


Gene Symbol KCNA6