Kv1.6 Antibody

Immunohistochemistry-Paraffin: Kv1.6 Antibody [NBP1-89717] - Staining of human pancreas shows moderate cytoplasmic positivity.

Product Discontinued

Kv1.6 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GRGGNNGGVSRVSPVSRGSQEEEEDEDDSYTFHHGITPGEMGTG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNA6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Kv1.6 Antibody

• FLJ25134
• HBK2
• human brain potassium channel-2
• KCNA6
• Kv1.6
• potassium voltage-gated channel subfamily A member 6
• potassium voltage-gated channel, shaker-related subfamily, member 6
• Voltage-gated potassium channel HBK2
• voltage-gated potassium channel protein Kv1.6
• Voltage-gated potassium channel subunit Kv1.6

Background

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homologs. This protein is a member of the potassium channel, voltage-gated, shaker-related subfamily. Kv1.6 contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class. The coding region of this gene is intronless, and the gene is clustered with genes KCNA1 and KCNA5 on chromosome 12. Kv1.6 is a homologue of the Drosophila gene Shaker, which is involved in reduced sleep and life expectancy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNA6