Recombinant Human Kv11.2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Kv11.2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 31-110 of Human Kv11.2

Source: Wheat Germ

Amino Acid Sequence: IANAQMENCAIIYCNDGFCELFGYSRVEVMQQPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLV

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
KCNH6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
34.54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Kv11.2 Protein

  • eag related protein 2
  • eag-related gene member 2
  • Eag-related protein 2
  • ERG2
  • ERG-2
  • ether-a-go-go related gene potassium channel 2
  • Ether-a-go-go-related gene potassium channel 2
  • Ether-a-go-go-related protein 2
  • HERG2
  • hERG-2
  • Kv11.2
  • potassium voltage-gated channel subfamily H member 6
  • potassium voltage-gated channel, subfamily H (eag-related), member 6
  • Voltage-gated potassium channel subunit Kv11.2

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. Several alternatively spliced transcript variants have been identified from this gene, but the full-length nature of only two transcript variants has been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003757-Q01
Species: Hu
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12897
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84813
Species: Hu
Applications: IHC, IHC-P
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP2-55973
Species: Hu
Applications: WB, ICC/IF
NBP2-66139
Species: Hu
NBP2-38146
Species: Hu
Applications: IHC, IHC-P
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NLS7412
Species: Hu, Mu, Rt, Po, Bt, Bv, Eq, Mk, Pm
Applications: IHC, IHC-P
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84935
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-75552
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
AF640
Species: Mu
Applications: WB, IHC
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NBP1-82864
Species: Hu
Applications: IHC, IHC-P
H00081033-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Kv11.2 Partial Recombinant Protein (H00081033-Q01) (0)

There are no publications for Kv11.2 Partial Recombinant Protein (H00081033-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv11.2 Partial Recombinant Protein (H00081033-Q01) (0)

There are no reviews for Kv11.2 Partial Recombinant Protein (H00081033-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv11.2 Partial Recombinant Protein (H00081033-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Kv11.2 Partial Recombinant Protein (H00081033-Q01)

Discover related pathways, diseases and genes to Kv11.2 Partial Recombinant Protein (H00081033-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv11.2 Partial Recombinant Protein (H00081033-Q01)

Discover more about diseases related to Kv11.2 Partial Recombinant Protein (H00081033-Q01).
 

Pathways for Kv11.2 Partial Recombinant Protein (H00081033-Q01)

View related products by pathway.

PTMs for Kv11.2 Partial Recombinant Protein (H00081033-Q01)

Learn more about PTMs related to Kv11.2 Partial Recombinant Protein (H00081033-Q01).

Blogs on Kv11.2

There are no specific blogs for Kv11.2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

EGR2 Antibody
NB110-59723
ERG Antibody
NBP2-60655

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Kv11.2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNH6