KLHL4 Antibody

Images

 
Western Blot: KLHL4 Antibody [NBP1-80343] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Eq, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KLHL4 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human KLHL4. Peptide sequence CLQQEGYEHRGTPVQGRLKSHSRDRNGLKKSNSPVHHNILAPVPGPAPAH.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLHL4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against KLHL4 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KLHL4 Antibody

  • kelch (Drosophila)-like 4
  • kelch-like 4 (Drosophila)
  • kelch-like protein 4
  • KHL4
  • KIAA1687DKELCHL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80386
Species: Hu
Applications: WB, IHC, IHC-P
AF1914
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NBP2-01926
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02939
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-59448
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-90824
Species: Hu
Applications: WB, ICC/IF
AF475
Species: Mu
Applications: WB, IHC
NBP1-69571
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb
Applications: WB, IHC, IHC-P
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for KLHL4 Antibody (NBP1-80343) (0)

There are no publications for KLHL4 Antibody (NBP1-80343).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLHL4 Antibody (NBP1-80343) (0)

There are no reviews for KLHL4 Antibody (NBP1-80343). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLHL4 Antibody (NBP1-80343) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KLHL4 Products

Bioinformatics Tool for KLHL4 Antibody (NBP1-80343)

Discover related pathways, diseases and genes to KLHL4 Antibody (NBP1-80343). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLHL4 Antibody (NBP1-80343)

Discover more about diseases related to KLHL4 Antibody (NBP1-80343).

Blogs on KLHL4

There are no specific blogs for KLHL4, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLHL4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLHL4
Uniprot