KIR3DX1 Antibody

Images

 
Immunohistochemistry-Paraffin: KIR3DX1 Antibody [NBP2-14160] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIR3DX1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CVGIYKHASKWSAESNSLKIIVTGLFTKPSISAHPSSLVHAGARVSLRCH SELAFDEFILYKEGHIQHSQQLDQGME
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIR3DX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KIR3DX1 Protein (NBP2-14160PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KIR3DX1 Antibody

  • FLJ00060
  • killer cell immunoglobulin-like receptor, three domains, X1
  • KIR3DL0
  • LENG12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB12251
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB2238
Species: Hu
Applications: Flow, AgAct, CyTOF-reported
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88102
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14160
Species: Hu
Applications: IHC, IHC-P

Publications for KIR3DX1 Antibody (NBP2-14160) (0)

There are no publications for KIR3DX1 Antibody (NBP2-14160).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIR3DX1 Antibody (NBP2-14160) (0)

There are no reviews for KIR3DX1 Antibody (NBP2-14160). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KIR3DX1 Antibody (NBP2-14160) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIR3DX1 Products

Bioinformatics Tool for KIR3DX1 Antibody (NBP2-14160)

Discover related pathways, diseases and genes to KIR3DX1 Antibody (NBP2-14160). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KIR3DX1

There are no specific blogs for KIR3DX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIR3DX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIR3DX1