KIAA0319 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: KTKYTILDNMDEQERMELRPKYGIKHRSTEHNSSLMVSESEFDSDQDTIFSREKMERGNPKVSMNGSIRNGASFSYCSKD |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KIAA0319 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100 |
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Protein A purified |
Alternate Names for KIAA0319 Antibody
Background
The longest isoform encoded by this gene is a transmembrane protein that is both N- and O-glycosylated. Defects in this gene may cause susceptibility to dyslexia type 2 (DYX2). Multiple transcript variants encoding several different isoforms have been found for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Rt
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Hu
Applications: IHC-P, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IM, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF
Publications for KIAA0319 Antibody (NBP2-69015) (0)
There are no publications for KIAA0319 Antibody (NBP2-69015).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KIAA0319 Antibody (NBP2-69015) (0)
There are no reviews for KIAA0319 Antibody (NBP2-69015).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KIAA0319 Antibody (NBP2-69015) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KIAA0319 Products
Research Areas for KIAA0319 Antibody (NBP2-69015)
Find related products by research area.
|
Blogs on KIAA0319