KIAA0319 Antibody

Immunocytochemistry/Immunofluorescence: KIAA0319 Antibody [NBP2-69015] - Staining of human cell line HeLa shows localization to vesicles.

Product Discontinued

KIAA0319 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KTKYTILDNMDEQERMELRPKYGIKHRSTEHNSSLMVSESEFDSDQDTIFSREKMERGNPKVSMNGSIRNGASFSYCSKD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIAA0319
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Reactivity Notes

Mouse 84%, Rat 84%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for KIAA0319 Antibody

• 4930451E12Rik
• D130043K22
• DLX2
• DYLX2
• dyslexia susceptibility 2
• DYX2
• KIAA0319
• MGC176717
• NMIG

Background

The longest isoform encoded by this gene is a transmembrane protein that is both N- and O-glycosylated. Defects in this gene may cause susceptibility to dyslexia type 2 (DYX2). Multiple transcript variants encoding several different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KIAA0319