KIAA0319 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KIAA0319 Antibody [NBP2-69015] - Staining of human cell line HeLa shows localization to vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KIAA0319 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KTKYTILDNMDEQERMELRPKYGIKHRSTEHNSSLMVSESEFDSDQDTIFSREKMERGNPKVSMNGSIRNGASFSYCSKD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA0319
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
KIAA0319 Recombinant Protein Antigen (NBP2-69015PEP)

Reactivity Notes

Mouse 84%, Rat 84%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for KIAA0319 Antibody

  • 4930451E12Rik
  • D130043K22
  • DLX2
  • DYLX2
  • dyslexia susceptibility 2
  • DYX2
  • KIAA0319
  • MGC176717
  • NMIG

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-68766
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-84298
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-57578
Species: Hu
Applications: WB
NBP1-88036
Species: Hu
Applications: IHC, IHC-P, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP1-87349
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF1749
Species: Rt
Applications: IHC, WB
NBP2-50071
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P
H00006936-B01P
Species: Hu
Applications: ICC/IF, WB
H00079932-T01
Species: Hu
Applications: WB
NBP2-97473
Species: Hu
Applications: IHC-P, IP, WB
AF5647
Species: Hu, Mu
Applications: ICC, WB
NBP2-24655
Species: Hu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-79775
Species: Hu
Applications: IHC, IHC-P, PA, WB
NBP2-36568
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC, IHC-P, WB
NBP1-87076
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-76567
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
AF1440
Species: Mu
Applications: WB
NBP1-88182
Species: Hu
Applications: IHC, IHC-P, WB

Publications for KIAA0319 Antibody (NBP2-69015) (0)

There are no publications for KIAA0319 Antibody (NBP2-69015).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIAA0319 Antibody (NBP2-69015) (0)

There are no reviews for KIAA0319 Antibody (NBP2-69015). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KIAA0319 Antibody (NBP2-69015) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIAA0319 Products

Bioinformatics Tool for KIAA0319 Antibody (NBP2-69015)

Discover related pathways, diseases and genes to KIAA0319 Antibody (NBP2-69015). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KIAA0319 Antibody (NBP2-69015)

Discover more about diseases related to KIAA0319 Antibody (NBP2-69015).
 

Pathways for KIAA0319 Antibody (NBP2-69015)

View related products by pathway.

PTMs for KIAA0319 Antibody (NBP2-69015)

Learn more about PTMs related to KIAA0319 Antibody (NBP2-69015).
 

Research Areas for KIAA0319 Antibody (NBP2-69015)

Find related products by research area.

Blogs on KIAA0319

There are no specific blogs for KIAA0319, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIAA0319 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA0319