KCTD9 Antibody

Images

 
Western Blot: KCTD9 Antibody [NBP1-57662] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KCTD9 Antibody Summary

Immunogen
Synthetic peptides corresponding to KCTD9 (potassium channel tetramerisation domain containing 9) The peptide sequence was selected from the middle region of KCTD9. Peptide sequence AHANLCCANLERADLSGSVLDCANLQGVKMLCSNAEGASLKLCNFEDPSG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCTD9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against KCTD9 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for KCTD9 Antibody

  • BTB/POZ domain-containing protein KCTD9
  • FLJ20038
  • potassium channel tetramerisation domain containing 9

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
7270-IL/CF
Species: Hu
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00010875-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
AF7036
Species: Hu
Applications: IHC
NBP1-57662
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB

Publications for KCTD9 Antibody (NBP1-57662) (0)

There are no publications for KCTD9 Antibody (NBP1-57662).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCTD9 Antibody (NBP1-57662) (0)

There are no reviews for KCTD9 Antibody (NBP1-57662). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KCTD9 Antibody (NBP1-57662) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KCTD9 Products

Bioinformatics Tool for KCTD9 Antibody (NBP1-57662)

Discover related pathways, diseases and genes to KCTD9 Antibody (NBP1-57662). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCTD9 Antibody (NBP1-57662)

Discover more about diseases related to KCTD9 Antibody (NBP1-57662).
 

Pathways for KCTD9 Antibody (NBP1-57662)

View related products by pathway.

Blogs on KCTD9

There are no specific blogs for KCTD9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCTD9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCTD9
Uniprot