KCTD9 Antibody (4Y6K9)

Western Blot: KCTD9 Antibody (4Y6K9) [NBP3-33256] - Western blot analysis of various lysates using KCTD9 Rabbit mAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4Y6K9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

KCTD9 Antibody (4Y6K9) Summary

• Description: Novus Biologicals Rabbit KCTD9 Antibody (4Y6K9) (NBP3-33256) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KCTD9 (Q7L273).
  
  Sequence:
  MRRVTLFLNGSPKNGKVVAVYGTLSDLLSVASSKLGIKATSVYNGKGGLIDDIALIRDDDVLFVCEGEPFIDPQTDSKPPEGLLGFHTDWLTLNVGGRYF
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: KCTD9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 43 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KCTD9 Antibody (4Y6K9)

• BTB/POZ domain-containing protein KCTD9
• FLJ20038
• potassium channel tetramerisation domain containing 9

Background

KCTD9( AAH21216, 1 a.a. - 390 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCTD9