KCTD20 Antibody - BSA Free

Western Blot: KCTD20 Antibody [NBP2-83106] - Host: Rabbit. Target Name: KCTD20. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

KCTD20 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human KCTD20. Peptide sequence: DSVDWDEDHPPPMGEEYSQILYSSKLYRFFKYIENRDVAKTVLKERGLKN The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCTD20
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for KCTD20 Antibody - BSA Free

• BTB/POZ domain-containing protein KCTD20
• potassium channel tetramerisation domain containing 20

Background

KCTD20, also known as BTB/POZ domain-containing protein KCTD20, consists of a 419 amino acid long isoform that is 47 kDa and a shorter 253 amino acid isoform that is 29 kDa. This protein has also been shown to have interactions with MARK4, MAP3K8, UBC, and PPP1CA. KCTD20 is also called Potassium Channel Tetramerisation Domain Containing 20.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCTD20