Recombinant Human KCNRG Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human KCNRG Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 100 of Human KCNRG partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIFVDRDGDLFSFILDFLRTHQLLLPTEFSDYLRLQREALFYELRSLVDLLNP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
KCNRG
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KCNRG Protein

  • CLLD4
  • potassium channel regulatorDLTET
  • Protein CLLD4
  • putative potassium channel regulatory protein

Background

KCNRG is a soluble protein with characteristics suggesting it forms heterotetramers with voltage-gated K(+) channels (see MIM 176260) and inhibits their function (Ivanov et al., 2003 [PubMed 12650944]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48725
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P
AF3758
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NLS836
Species: Hu, Mk, Pm
Applications: IHC-P
MAB6184
Species: Mu
Applications: WB, CyTOF-ready, ICFlow
NBP1-82874
Species: Hu
Applications: IHC, IHC-P
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
26660002
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP1-89691
Species: Hu
Applications: IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-24470
Species: Hu
Applications: WB, Simple Western, IHC-P
AF7318
Species: Hu
Applications: IHC
H00006444-M01-100ug
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF2746
Species: Hu, Mu
Applications: WB, ICC
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00283518-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for KCNRG Partial Recombinant Protein (H00283518-Q01) (0)

There are no publications for KCNRG Partial Recombinant Protein (H00283518-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNRG Partial Recombinant Protein (H00283518-Q01) (0)

There are no reviews for KCNRG Partial Recombinant Protein (H00283518-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KCNRG Partial Recombinant Protein (H00283518-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KCNRG Products

Bioinformatics Tool for KCNRG Partial Recombinant Protein (H00283518-Q01)

Discover related pathways, diseases and genes to KCNRG Partial Recombinant Protein (H00283518-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNRG Partial Recombinant Protein (H00283518-Q01)

Discover more about diseases related to KCNRG Partial Recombinant Protein (H00283518-Q01).
 

Pathways for KCNRG Partial Recombinant Protein (H00283518-Q01)

View related products by pathway.

Blogs on KCNRG

There are no specific blogs for KCNRG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

KCNRG Antibody
H00283518-B01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KCNRG Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNRG