KCNMB4 Antibody - BSA Free

Western Blot: KCNMB4 Antibody [NBP3-10360] - Western blot analysis using NBP3-10360 on Human THP-1 as a positive control. Antibody Titration: 0.2-1 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

KCNMB4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KCNMB4 Antibody - BSA Free (NBP3-10360) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNMB4 (NP_055320). Peptide sequence TCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCK
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNMB4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for KCNMB4 Antibody - BSA Free

• BK channel subunit beta-4
• BKbeta4
• calcium-activated potassium channel subunit beta-4
• Calcium-activated potassium channel, subfamily M subunit beta-4
• Charybdotoxin receptor subunit beta-4
• hbeta4
• k(VCA)beta-4
• large conductance calcium-dependent potassium ion channel beta 4 subunit
• Maxi K channel subunit beta-4
• potassium large conductance calcium-activated channel, subfamily M, beta member4
• slo-beta-4

Background

KCNMB4, also known as Calcium-activated potassium channel subunit beta-4, is a 210 amino acid protein that is 34 kDa; predominantly expressed in brain; regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channels which are fundamental to the control of smooth muscle tone and neuronal excitability; is an auxiliary beta subunit which slows activation kinetics, leads to steeper calcium sensitivity, and shifts the voltage range of current activation to more negative potentials than does the beta 1 subunit. Current research is being pursued on this protein involvement in several diseases and disorders including neurological disorder, corpus callosum, epilepsy syndrome, seizures, neuronitis, and cerebritis. This protein has been linked to the hemostasis, potassium channels, Ca2+ activated K+ channels, cGMP effects, platelet homeostasis, synaptic transmission- ion currents, and vascular smooth muscle contraction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNMB4