Kallikrein 8/Neuropsin Recombinant Protein Antigen

• Reactivity: Hu
• Applications: Binding Activity
• Concentration: 0.5 mg/ml

Kallikrein 8/Neuropsin Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Kallikrein 8/Neuropsin.
  
  

  Source: E. coli

  Amino Acid Sequence: GSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCEGDSGG

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: KLK8
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-05517.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

  For further blocking tide related information and a protocol, click here.

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Concentration: 0.5 mg/ml
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kallikrein 8/Neuropsin Recombinant Protein Antigen

• EC 3.4.21
• EC 3.4.21.118
• hK8
• HNP
• kallikrein 8 (neuropsin/ovasin)
• Kallikrein 8
• kallikrein-related peptidase 8
• KLK8 protein type 1
• KLK8 protein type 2
• KLK8
• neuropsin type 1
• neuropsin type 2
• Neuropsin
• NP
• NRPN
• Ovasin
• PRSS19
• PRSS19kallikrein-8
• Serine protease 19
• Serine protease TADG-14
• TADG14neuropsin
• Tumor-associated differentially expressed gene 14 protein

Background

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing of this gene results in four transcript variants encoding four different isoforms. The isoforms exhibit distinct patterns of expression that suggest roles in brain plasticity and ovarian cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KLK8