Kallikrein 8/Neuropsin Recombinant Protein Antigen

Images

 
There are currently no images for Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Binding Activity
Concentration
0.5 mg/ml

Order Details

Kallikrein 8/Neuropsin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Kallikrein 8/Neuropsin.

Source: E. coli

Amino Acid Sequence: GSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCEGDSGG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KLK8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-05517.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Concentration
0.5 mg/ml
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kallikrein 8/Neuropsin Recombinant Protein Antigen

  • EC 3.4.21
  • EC 3.4.21.118
  • hK8
  • HNP
  • kallikrein 8 (neuropsin/ovasin)
  • Kallikrein 8
  • kallikrein-related peptidase 8
  • KLK8 protein type 1
  • KLK8 protein type 2
  • KLK8
  • neuropsin type 1
  • neuropsin type 2
  • Neuropsin
  • NP
  • NRPN
  • Ovasin
  • PRSS19
  • PRSS19kallikrein-8
  • Serine protease 19
  • Serine protease TADG-14
  • TADG14neuropsin
  • Tumor-associated differentially expressed gene 14 protein

Background

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing of this gene results in four transcript variants encoding four different isoforms. The isoforms exhibit distinct patterns of expression that suggest roles in brain plasticity and ovarian cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2008
Species: Hu
Applications: IHC, IP, WB
NLS2144
Species: Bt, Bv, Ca, Eq, Hu, Pm, Mu, Rb
Applications: IHC, IHC-P
MAB2337
Species: Hu
Applications: IP, WB
AF2624
Species: Hu, Mu
Applications: IHC, IP, WB
1719-SE
Species: Hu
Applications: EnzAct
DY8198-05
Species: Hu
Applications: ELISA
1108-SE
Species: Hu
Applications: EnzAct
2626-SE
Species: Hu
Applications: EnzAct
DKK300
Species: Hu
Applications: ELISA
AF1595
Species: Hu
Applications: IHC, IP, WB
H00001668-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
AF5866
Species: Hu
Applications: IHC, WB
AF2758
Species: Hu
Applications: IHC, WB
H00005655-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF2625
Species: Hu
Applications: IHC, IP, Neut, WB
NBP2-01650
Species: Hu, Pm, Mu
Applications: Flow, IHC, IHC-P, WB
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
NBP3-05517PEP
Species: Hu
Applications: Binding Activity

Publications for Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP) (0)

There are no publications for Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP) (0)

There are no reviews for Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kallikrein 8/Neuropsin Products

Bioinformatics Tool for Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP)

Discover related pathways, diseases and genes to Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP)

Discover more about diseases related to Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP).
 

Pathways for Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP)

View related products by pathway.

PTMs for Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP)

Learn more about PTMs related to Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP).
 

Research Areas for Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP)

Find related products by research area.

Blogs on Kallikrein 8/Neuropsin

There are no specific blogs for Kallikrein 8/Neuropsin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kallikrein 8/Neuropsin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KLK8