Kallikrein 8/Neuropsin Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Kallikrein 8/Neuropsin. Source: E. coli
Amino Acid Sequence: GSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCEGDSGG Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
KLK8 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10-100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-05517. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking tide related information and a protocol, click here. |
Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Concentration |
0.5 mg/ml |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Kallikrein 8/Neuropsin Recombinant Protein Antigen
Background
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing of this gene results in four transcript variants encoding four different isoforms. The isoforms exhibit distinct patterns of expression that suggest roles in brain plasticity and ovarian cancer.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IP, WB
Species: Bt, Bv, Ca, Eq, Hu, Pm, Mu, Rb
Applications: IHC, IHC-P
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: IHC, IP, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA
Species: Hu
Applications: EnzAct
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, Neut, WB
Species: Hu, Pm, Mu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu
Applications: Binding Activity
Publications for Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP) (0)
There are no publications for Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP) (0)
There are no reviews for Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP) (0)
Additional Kallikrein 8/Neuropsin Products
Bioinformatics Tool for Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP)
Discover related pathways, diseases and genes to Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP)
Discover more about diseases related to Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP).
| | Pathways for Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP)
View related products by pathway.
|
PTMs for Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP)
Learn more about PTMs related to Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP).
| | Research Areas for Kallikrein 8/Neuropsin Recombinant Protein Antigen (NBP3-05517PEP)
Find related products by research area.
|
Blogs on Kallikrein 8/Neuropsin