Kallikrein 5 Antibody - BSA Free

Staining of human skin shows cytoplasmic positivity in epidermal cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Kallikrein 5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Kallikrein 5 Antibody - BSA Free (NBP3-24933) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Kallikrein 5 using the following amino acid sequence: GTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLK5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Kallikrein 5 Antibody - BSA Free

• EC 3.4.21
• EC 3.4.21.4
• Kallikrein 5
• Kallikrein-like protein 2
• kallikrein-related peptidase 5
• KLK5
• KLKL2
• KLK-L2
• KLK-L2EC 3.4.21.-
• SCTE
• SCTEkallikrein-5
• Stratum corneum tryptic enzyme

Background

Kallikreins are a subgroup of serine proteases and are implicated in carcinogenesis. The novel KLK gene, KLK-L2 is expressed in breast, brain, and testis and is up-regulated by estrogens and progestins

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KLK5