Kallikrein 13 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: LKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLNHDHDIMLLELQSPVQLTGYIQTLPLSHNNRLTPGTT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KLK13 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Kallikrein 13 Antibody
Background
KLK13, also known as Kallikrein 13, is a 30,6 kDa 277 amino acid protein, expressed in prostate, breast, testis and salivary gland, belongs to the peptidase S1 family, kallikrein subfamily. Kallikreins are a subgroup of serine proteases having diverse physiological functions including their implication in carcinogenesis based on growing evidence. Disease research is currently being studied with relation to KLK13 and ovarian cancer, breast cancer, noma, testicular cancer, lung adenocarcinoma, prostatitis, prostate cancer, and carcinoma. Interactions with KLK13 protein have been shown to involve SERPINF2, SERPINA1, and A2M in proteolysis and protein processing pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: EnzAct
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: EnzAct
Species: Hu
Applications: EnzAct
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Mu
Applications: IP, WB
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Publications for Kallikrein 13 Antibody (NBP2-49358) (0)
There are no publications for Kallikrein 13 Antibody (NBP2-49358).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Kallikrein 13 Antibody (NBP2-49358) (0)
There are no reviews for Kallikrein 13 Antibody (NBP2-49358).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Kallikrein 13 Antibody (NBP2-49358) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Kallikrein 13 Products
Research Areas for Kallikrein 13 Antibody (NBP2-49358)
Find related products by research area.
|
Blogs on Kallikrein 13