JRK Recombinant Protein Antigen

Images

 
There are currently no images for JRK Recombinant Protein Antigen (NBP2-55780PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

JRK Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human JRK.

Source: E. coli

Amino Acid Sequence: LELVKEGSSCPGQLRQRQAASWGVAGREAEGGRPPAATSPAEVVWSSEKTPKADQDGGGDPGEGEEVAWEQAAVAFDAVLRFAERQPCFSA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
JRK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55780.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for JRK Recombinant Protein Antigen

  • DKFZp686C24207
  • FLJ45729
  • jerky homolog (mouse)
  • jerky protein homolog
  • JH8jerky (mouse) homolog

Background

JRK is the human homolog of the mouse jerky gene. The encoded protein has similarity to several nuclear regulatory proteins, including centromere protein B, suggesting that it might function as a DNA-binding protein. Insertional inactivation of this gene in transgenic mice resulted in epileptic seizures. Childhood Absence Epilepsy (CAE) has been mapped to the same chromosomal location (8q24.3) as this gene, making this gene a strong candidate for CAE. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-40853
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP2-87194
Species: Hu
Applications: WB
NB100-126
Species: Hu, Mu
Applications: ChIP, WB
NBP2-24589
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC,  IHC-P, KO, Simple Western, WB
NBP1-31470
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-2559
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
664-LI
Species: Hu
Applications: BA
H00001059-B01P
Species: Hu
Applications: ICC/IF, WB
NBP1-80790
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
NBP1-77127
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-59787
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, PLA, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-68799
Species: Hu
Applications: IHC,  IHC-P

Publications for JRK Recombinant Protein Antigen (NBP2-55780PEP) (0)

There are no publications for JRK Recombinant Protein Antigen (NBP2-55780PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JRK Recombinant Protein Antigen (NBP2-55780PEP) (0)

There are no reviews for JRK Recombinant Protein Antigen (NBP2-55780PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for JRK Recombinant Protein Antigen (NBP2-55780PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional JRK Products

Array NBP2-55780PEP

Blogs on JRK

There are no specific blogs for JRK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our JRK Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol JRK