JAZF1 Antibody

Western Blot: JAZF1 Antibody [NBP2-57403] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunocytochemistry/Immunofluorescence: JAZF1 Antibody [NBP2-57403] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center. Antibody staining is shown in green.

Product Discontinued

JAZF1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSSSFRSSTPTGSEYDEEEVDYEESDSDESWTTESAISSEAIL
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: JAZF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for JAZF1 Antibody

• JAZF zinc finger 1
• juxtaposed with another zinc finger gene 1
• juxtaposed with another zinc finger protein 1
• TAK1-interacting protein 27
• TIP27ZNF802DKFZp761K2222
• Zinc finger protein 802

Background

The JAZF1 gene encodes a nuclear protein with three C2H2-type zinc fingers, and functions as a transcriptional repressor.Chromosomal aberrations involving this gene are associated with endometrial stromal tumors. Alternatively splicedvariants which encode diff

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: JAZF1