JAZF1 Antibody

Images

 
Western Blot: JAZF1 Antibody [NBP2-57403] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: JAZF1 Antibody [NBP2-57403] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

JAZF1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSSSFRSSTPTGSEYDEEEVDYEESDSDESWTTESAISSEAIL
Specificity
Specificity of human JAZF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
JAZF1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for JAZF1 Antibody

  • JAZF zinc finger 1
  • juxtaposed with another zinc finger gene 1
  • juxtaposed with another zinc finger protein 1
  • TAK1-interacting protein 27
  • TIP27ZNF802DKFZp761K2222
  • Zinc finger protein 802

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4184
Species: Hu, Mu
Applications: WB, IP, ICC
H00006934-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-82916
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-27347
Species: Hu
Applications: WB
H00007103-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20615
Species: Hu
Applications: WB
MAB7936
Species: Hu
Applications: IHC, CyTOF-ready, ICFlow
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
H00003087-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32796
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45600
Species: Hu, Ca, Mk
Applications: WB, IHC, IF
NBP1-85589
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for JAZF1 Antibody (NBP2-57403) (0)

There are no publications for JAZF1 Antibody (NBP2-57403).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for JAZF1 Antibody (NBP2-57403) (0)

There are no reviews for JAZF1 Antibody (NBP2-57403). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for JAZF1 Antibody (NBP2-57403) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional JAZF1 Products

Bioinformatics Tool for JAZF1 Antibody (NBP2-57403)

Discover related pathways, diseases and genes to JAZF1 Antibody (NBP2-57403). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JAZF1 Antibody (NBP2-57403)

Discover more about diseases related to JAZF1 Antibody (NBP2-57403).
 

Pathways for JAZF1 Antibody (NBP2-57403)

View related products by pathway.

PTMs for JAZF1 Antibody (NBP2-57403)

Learn more about PTMs related to JAZF1 Antibody (NBP2-57403).

Blogs on JAZF1

There are no specific blogs for JAZF1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our JAZF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol JAZF1
COVID-19 update