IQM1 Antibody - BSA Free

Immunohistochemistry-Paraffin: IQM1 Antibody [NBP2-55498] - Staining in human cerebral cortex and pancreas tissues using anti-PCP4L1 antibody. Corresponding PCP4L1 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: IQM1 Antibody [NBP2-55498] - Staining of human cell line CACO-2 shows localization to nucleoplasm & mitochondria.

Immunohistochemistry-Paraffin: IQM1 Antibody [NBP2-55498] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: IQM1 Antibody [NBP2-55498] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: IQM1 Antibody [NBP2-55498] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IQM1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IQM1 Antibody - BSA Free (NBP2-55498) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ELNTKTSPATNQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEKAALAIQGKFR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCP4L1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. IHC-P, Retrieval method: HIER pH6.
• Control Peptide:

  IQM1 Recombinant Protein Antigen (NBP2-55498PEP)

Reactivity Notes

Mouse 85%, Rat 85%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IQM1 Antibody - BSA Free

• PCP4L1
• PCP4-like protein 1
• Purkinje cell protein 4 like protein 1
• Purkinje cell protein 4-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PCP4L1