Recombinant Human INPP5A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human INPP5A Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 288 - 387 of Human INPP5A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELVLRVSVCCPSPGHRGMWSAGSGLAQPW

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
INPP5A
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human INPP5A Protein

  • 43 kDa inositol polyphosphate 5-phophatase
  • CTCL tumor antigen HD-CL-02,5PTASE
  • DKFZp434A1721
  • EC 3.1.3.56
  • inositol polyphosphate-5-phosphatase, 40kD
  • inositol polyphosphate-5-phosphatase, 40kDa
  • inositol trisphosphate-5-phosphatase, 40kD
  • InsP3 5-phosphatase
  • MGC116947,5PTase
  • MGC116949
  • type I inositol-14,5-trisphosphate 5-phophatase
  • type I inositol-14,5-trisphosphate 5-phosphatase

Background

INPP5A - inositol polyphosphate-5-phosphatase, 40kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89439
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-22568
Species: Hu
Applications: IHC-P
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81590
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4208
Species: Rt
Applications: WB
NBP2-19833
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
H00004867-D01P
Species: Hu, Mu
Applications: WB
H00002189-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
H00003632-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for INPP5A Partial Recombinant Protein (H00003632-Q01) (0)

There are no publications for INPP5A Partial Recombinant Protein (H00003632-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INPP5A Partial Recombinant Protein (H00003632-Q01) (0)

There are no reviews for INPP5A Partial Recombinant Protein (H00003632-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INPP5A Partial Recombinant Protein (H00003632-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional INPP5A Products

Bioinformatics Tool for INPP5A Partial Recombinant Protein (H00003632-Q01)

Discover related pathways, diseases and genes to INPP5A Partial Recombinant Protein (H00003632-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INPP5A Partial Recombinant Protein (H00003632-Q01)

Discover more about diseases related to INPP5A Partial Recombinant Protein (H00003632-Q01).
 

Pathways for INPP5A Partial Recombinant Protein (H00003632-Q01)

View related products by pathway.

PTMs for INPP5A Partial Recombinant Protein (H00003632-Q01)

Learn more about PTMs related to INPP5A Partial Recombinant Protein (H00003632-Q01).
 

Research Areas for INPP5A Partial Recombinant Protein (H00003632-Q01)

Find related products by research area.

Blogs on INPP5A

There are no specific blogs for INPP5A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

INPP5A Antibody
NBP1-89361

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human INPP5A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol INPP5A