INPP4B Antibody - BSA Free

Western Blot: INPP4B Antibody [NBP2-87626] - Host: Rabbit. Target Name: INPP4B. Sample Tissue: Human Ovary Tumor. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

INPP4B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit INPP4B Antibody - BSA Free (NBP2-87626) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human INPP4B. Peptide sequence: HHSDYDEEEWDRVWANVGKSLNCIIAMVDKLIERDGGSEGSGGNNDGEKE The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: INPP4B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for INPP4B Antibody - BSA Free

• inositol polyphosphate-4-phosphatase, type II, 105kDa
• type II inositol-3,4-bisphosphate 4-phosphatase

Background

INPP4B encodes the inositol polyphosphate 4-phosphatase type II, one of the enzymes involved in phosphatidylinositolsignaling pathways. This enzyme removes the phosphate group at position 4 of the inositol ring from inositol3,4-bisphosphate. There is limited data to suggest that the human type II enzyme is subject to alternative splicing,as has been established for the type I enzyme. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: INPP4B