INPP4B Antibody (3F2)

Images

 
Sandwich ELISA: INPP4B Antibody (3F2) [H00008821-M03] - Detection limit for recombinant GST tagged INPP4B is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3F2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

INPP4B Antibody (3F2) Summary

Immunogen
INPP4B (AAH05273, 1 a.a. - 53 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILDLNQELRD
Specificity
INPP4B - inositol polyphosphate-4-phosphatase, type II, 105kDa (3F2)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
INPP4B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for INPP4B Antibody (3F2)

  • inositol polyphosphate-4-phosphatase, type II, 105kDa
  • type II inositol-3,4-bisphosphate 4-phosphatase

Background

INPP4B encodes the inositol polyphosphate 4-phosphatase type II, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 4 of the inositol ring from inositol 3,4-bisphosphate. There is limited data to suggest that the human type II enzyme is subject to alternative splicing, as has been established for the type I enzyme. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
MAB2317
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
26160002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP2-49463
Species: Hu
Applications: IHC, IHC-P
NBP2-19621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-15832
Species: Hu
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-13510
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for INPP4B Antibody (H00008821-M03) (0)

There are no publications for INPP4B Antibody (H00008821-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INPP4B Antibody (H00008821-M03) (0)

There are no reviews for INPP4B Antibody (H00008821-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INPP4B Antibody (H00008821-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional INPP4B Products

Bioinformatics Tool for INPP4B Antibody (H00008821-M03)

Discover related pathways, diseases and genes to INPP4B Antibody (H00008821-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INPP4B Antibody (H00008821-M03)

Discover more about diseases related to INPP4B Antibody (H00008821-M03).
 

Pathways for INPP4B Antibody (H00008821-M03)

View related products by pathway.

PTMs for INPP4B Antibody (H00008821-M03)

Learn more about PTMs related to INPP4B Antibody (H00008821-M03).
 

Research Areas for INPP4B Antibody (H00008821-M03)

Find related products by research area.

Blogs on INPP4B

There are no specific blogs for INPP4B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our INPP4B Antibody (3F2) and receive a gift card or discount.

Bioinformatics

Gene Symbol INPP4B
Entrez
Uniprot