INPP4B Antibody (3F2)


Sandwich ELISA: INPP4B Antibody (3F2) [H00008821-M03] - Detection limit for recombinant GST tagged INPP4B is 1 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

INPP4B Antibody (3F2) Summary

INPP4B (AAH05273, 1 a.a. - 53 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILDLNQELRD
INPP4B - inositol polyphosphate-4-phosphatase, type II, 105kDa (3F2)
IgG2b Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for INPP4B Antibody (3F2)

  • inositol polyphosphate-4-phosphatase, type II, 105kDa
  • type II inositol-3,4-bisphosphate 4-phosphatase


INPP4B encodes the inositol polyphosphate 4-phosphatase type II, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 4 of the inositol ring from inositol 3,4-bisphosphate. There is limited data to suggest that the human type II enzyme is subject to alternative splicing, as has been established for the type I enzyme. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for INPP4B Antibody (H00008821-M03) (0)

There are no publications for INPP4B Antibody (H00008821-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INPP4B Antibody (H00008821-M03) (0)

There are no reviews for INPP4B Antibody (H00008821-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INPP4B Antibody (H00008821-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional INPP4B Products

Bioinformatics Tool for INPP4B Antibody (H00008821-M03)

Discover related pathways, diseases and genes to INPP4B Antibody (H00008821-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INPP4B Antibody (H00008821-M03)

Discover more about diseases related to INPP4B Antibody (H00008821-M03).

Pathways for INPP4B Antibody (H00008821-M03)

View related products by pathway.

PTMs for INPP4B Antibody (H00008821-M03)

Learn more about PTMs related to INPP4B Antibody (H00008821-M03).

Research Areas for INPP4B Antibody (H00008821-M03)

Find related products by research area.

Blogs on INPP4B

There are no specific blogs for INPP4B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our INPP4B Antibody (3F2) and receive a gift card or discount.


Gene Symbol INPP4B