INPP4B Antibody (3F2) - Azide and BSA Free

Sandwich ELISA: INPP4B Antibody (3F2) [H00008821-M03] - Detection limit for recombinant GST tagged INPP4B is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3F2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

INPP4B Antibody (3F2) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: INPP4B (AAH05273, 1 a.a. ~ 53 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILDLNQELRD
• Specificity: INPP4B - inositol polyphosphate-4-phosphatase, type II, 105kDa (3F2)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: INPP4B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for INPP4B Antibody (3F2) - Azide and BSA Free

• inositol polyphosphate-4-phosphatase, type II, 105kDa
• type II inositol-3,4-bisphosphate 4-phosphatase

Background

INPP4B encodes the inositol polyphosphate 4-phosphatase type II, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 4 of the inositol ring from inositol 3,4-bisphosphate. There is limited data to suggest that the human type II enzyme is subject to alternative splicing, as has been established for the type I enzyme. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: INPP4B
• Entrez:
  • 8821(Human)
• Uniprot:
  • AAH05273(Human)