We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Importin 11 Recombinant Protein Antigen

Images

 
There are currently no images for Importin 11 Recombinant Protein Antigen (NBP2-49505PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Importin 11 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Importin 11.

Source: E. coli

Amino Acid Sequence: QLLGNMIEMWVDRMDNITQPERRKLSALALLSLLPSDNSVIQDKFCGIINISVEGLHDVMTEDPETGTYKDCMLMSHLEEPKVTEDEEPPTEQD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IPO11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49505.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Importin 11 Recombinant Protein Antigen

  • imp11
  • importin 11
  • Ran binding protein 11
  • Ran-binding protein 11
  • RANBP11
  • RanBP11importin-11
  • SLRN

Background

Principal Names: Importin-11 (IPO11); Imp11; Ran-binding protein 11 (RanBP11); Official Gene Symbol: IPO11 Gene ID: 51194 (Human) Gene Map Locus: 5q12.1 (Human) Importin-11 is a novel member of Karyopherin family. Karyopherins are transport receptors that mediate the transport of protein and RNA across the nucleus and cytoplasm. Importin-11 consists of an N-terminal Ran-binding domain, a central cargo-binding region and C-terminal region. It interacts with Ran-GTPase and constitutively shuttles between the nucleus and cytoplasm. Reports suggest Importin-11 primarily mediates the transport of ribosomal protein L12 and UbcM2, an E2 ubiquitin-conjugating enzyme.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03819
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-78983
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB (-)
NBP2-20211
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP2-82489
Species: Hu
Applications: ELISA
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00008086-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB100-58788
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP3-03794
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB100-565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
NBP3-04411
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-02965
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-92556
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-1397
Species: Bv, Ca, Hu, Pm, Mu, Rb
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
MAB17582
Species: Mu
Applications: CyTOF-ready, Flow

Publications for Importin 11 Recombinant Protein Antigen (NBP2-49505PEP) (0)

There are no publications for Importin 11 Recombinant Protein Antigen (NBP2-49505PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Importin 11 Recombinant Protein Antigen (NBP2-49505PEP) (0)

There are no reviews for Importin 11 Recombinant Protein Antigen (NBP2-49505PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Importin 11 Recombinant Protein Antigen (NBP2-49505PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Importin 11 Products

Research Areas for Importin 11 Recombinant Protein Antigen (NBP2-49505PEP)

Find related products by research area.

Blogs on Importin 11

There are no specific blogs for Importin 11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Importin 11 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IPO11