ILT1/CD85h/LILRA2 Antibody (3C7) - Azide and BSA Free

Western Blot: ILT1/CD85h/LILRA2 Antibody (3C7) [H00011027-M17] - Analysis of LILRA2 expression in transfected 293T cell line by LILRA2 monoclonal antibody (M17), clone 3C7. Lane 1: LILRA2 transfected lysate (Predicted MW: 51.2 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3C7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ILT1/CD85h/LILRA2 Antibody (3C7) - Azide and BSA Free Summary

• Immunogen: LILRA2 (NP_006857, 322 a.a. ~ 383 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMG
• Specificity: LILRA2 - leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2 (3C7)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: LILRA2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ILT1/CD85h/LILRA2 Antibody (3C7) - Azide and BSA Free

• CD85 antigen-like family member H
• CD85h antigen
• CD85h
• ILT1
• ILT-1
• ILT1CD85H
• Leukocyte immunoglobulin-like receptor 7
• leukocyte immunoglobulin-like receptor subfamily A member 2 soluble
• leukocyte immunoglobulin-like receptor subfamily A member 2
• leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2
• LILRA2
• LIR7
• LIR7LIR-7Immunoglobulin-like transcript 1

Background

Leukocyte Ig-like receptors (LIRs) are a family of immunoreceptors expressed predominantly on monocytes and B cells and at lower levels on dendritic cells and natural killer (NK) cells. All LIRs in subfamily B have an inhibitory function (see, e.g., LILRB1, MIM 604811). LIRs in subfamily A, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades. One member of subfamily A (LILRA3; MIM 604818) lacks a transmembrane region and is presumed to be a soluble receptor.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LILRA2
• Entrez:
  • 11027(Human)
• Uniprot:
  • NP_006857()