ILDR1 Antibody

Images

 
Western Blot: ILDR1 Antibody [NBP1-69697] - This Anti-ILDR1 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ILDR1 Antibody Summary

Immunogen
Synthetic peptides corresponding to ILDR1(immunoglobulin-like domain containing receptor 1) The peptide sequence was selected from the middle region of ILDR1. Peptide sequence RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ILDR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ILDR1 and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ILDR1 Antibody

  • Angulin-2
  • autosomal recessive 42
  • DFNB42
  • ILDR1
  • ILDR1alpha
  • ILDR1alpha'
  • ILDR1beta
  • immunoglobulin-like domain containing receptor 1
  • immunoglobulin-like domain-containing receptor 1 alpha
  • immunoglobulin-like domain-containing receptor 1 alpha'
  • immunoglobulin-like domain-containing receptor 1 beta

Background

ILDR1 is a putative membrane receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89631
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00006223-M01
Species: Hu
Applications: WB, ELISA

Publications for ILDR1 Antibody (NBP1-69697) (0)

There are no publications for ILDR1 Antibody (NBP1-69697).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ILDR1 Antibody (NBP1-69697) (0)

There are no reviews for ILDR1 Antibody (NBP1-69697). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ILDR1 Antibody (NBP1-69697) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ILDR1 Products

Bioinformatics Tool for ILDR1 Antibody (NBP1-69697)

Discover related pathways, diseases and genes to ILDR1 Antibody (NBP1-69697). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ILDR1 Antibody (NBP1-69697)

Discover more about diseases related to ILDR1 Antibody (NBP1-69697).
 

Pathways for ILDR1 Antibody (NBP1-69697)

View related products by pathway.

Blogs on ILDR1

There are no specific blogs for ILDR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ILDR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ILDR1
Entrez
Uniprot