IL-28R alpha/IFN-lambda R1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

IL-28R alpha/IFN-lambda R1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IFNLR1.
  
  

  Source: E. coli

  Amino Acid Sequence: FEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEAN

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: IFNLR1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84381.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-28R alpha/IFN-lambda R1 Recombinant Protein Antigen

• class II cytokine receptor CRF2/12
• CRF2/12
• CRF2-12
• Cytokine receptor class-II member 12
• Cytokine receptor family 2 member 12
• IFN-lambda R1
• IFN-lambda receptor 1
• IFN-lambda-R1
• IFNLR
• IFNLR1
• IL-28 R alpha
• IL-28 receptor subunit alpha
• IL28R alpha
• IL-28R1
• IL28RA
• IL-28Ra
• IL-28R-alpha
• Interferon lambda receptor 1
• interferon lambda, receptor 1
• interleukin 28 receptor A
• interleukin 28 receptor, alpha (interferon, lambda receptor)
• interleukin 28 receptor, alpha
• interleukin or cytokine receptor 2
• interleukin-28 receptor subunit alpha
• LICR2
• Likely interleukin or cytokine receptor 2

Background

IL28RA is a class II cytokine receptor that interacts with IL10RB to bind IL28A, IL28B, and IL29, which are related to type I interferons. These ligands play a critical role in response to microbial challenge and activate the JAK/STAT signaling system. It heterodimers with IL10RB. There are 4 isoforms as result of alternative splicing. It is widely expressed. IL28RA belongs to the type II cytokine receptor family, and contains 1 fibronectin type III domain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: IFNLR1