IL-28R alpha/IFN-lambda R1 Recombinant Protein Antigen

Images

 
There are currently no images for IL-28R alpha/IFN-lambda R1 Recombinant Protein Antigen (NBP1-84381PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IL-28R alpha/IFN-lambda R1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IFNLR1.

Source: E. coli

Amino Acid Sequence: FEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEAN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IFNLR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84381.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-28R alpha/IFN-lambda R1 Recombinant Protein Antigen

  • class II cytokine receptor CRF2/12
  • CRF2/12
  • CRF2-12
  • Cytokine receptor class-II member 12
  • Cytokine receptor family 2 member 12
  • IFN-lambda R1
  • IFN-lambda receptor 1
  • IFN-lambda-R1
  • IFNLR
  • IFNLR1
  • IL-28 R alpha
  • IL-28 receptor subunit alpha
  • IL28R alpha
  • IL-28R1
  • IL28RA
  • IL-28Ra
  • IL-28R-alpha
  • Interferon lambda receptor 1
  • interferon lambda, receptor 1
  • interleukin 28 receptor A
  • interleukin 28 receptor, alpha (interferon, lambda receptor)
  • interleukin 28 receptor, alpha
  • interleukin or cytokine receptor 2
  • interleukin-28 receptor subunit alpha
  • LICR2
  • Likely interleukin or cytokine receptor 2

Background

IL28RA is a class II cytokine receptor that interacts with IL10RB to bind IL28A, IL28B, and IL29, which are related to type I interferons. These ligands play a critical role in response to microbial challenge and activate the JAK/STAT signaling system. It heterodimers with IL10RB. There are 4 isoforms as result of alternative splicing. It is widely expressed. IL28RA belongs to the type II cytokine receptor family, and contains 1 fibronectin type III domain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF874
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
DY417
Species: Mu
Applications: ELISA
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
PAF-ST2
Species: Hu
Applications: IP, KO, WB
DY413
Species: Mu
Applications: ELISA
NBP2-37320
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
485-MI
Species: Mu
Applications: BA
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF7946
Species: Hu
Applications: ICC, IHC, WB
AF2168
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
AF1584
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
NBP3-17081
Species: Hu
Applications: IHC,  IHC-P
NBP3-16867
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-76853
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-84381PEP
Species: Hu
Applications: AC

Publications for IL-28R alpha/IFN-lambda R1 Recombinant Protein Antigen (NBP1-84381PEP) (0)

There are no publications for IL-28R alpha/IFN-lambda R1 Recombinant Protein Antigen (NBP1-84381PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-28R alpha/IFN-lambda R1 Recombinant Protein Antigen (NBP1-84381PEP) (0)

There are no reviews for IL-28R alpha/IFN-lambda R1 Recombinant Protein Antigen (NBP1-84381PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IL-28R alpha/IFN-lambda R1 Recombinant Protein Antigen (NBP1-84381PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-28R alpha/IFN-lambda R1 Products

Research Areas for IL-28R alpha/IFN-lambda R1 Recombinant Protein Antigen (NBP1-84381PEP)

Find related products by research area.

Blogs on IL-28R alpha/IFN-lambda R1

There are no specific blogs for IL-28R alpha/IFN-lambda R1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IL-28R alpha/IFN-lambda R1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IFNLR1