IFTAP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C11orf74 Antibody [NBP1-83472] - Immunofluorescent staining of human cell line HEK 293 shows localization to cytosol & aggresome.
Immunohistochemistry-Paraffin: C11orf74 Antibody [NBP1-83472] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IFTAP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSAHMSGLEIMDEDQLIKDVLDKFLNCHEQTYDEEFLNTFTHLSQEDHVSKRGVFGTDSSE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C11ORF74
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IFTAP Recombinant Protein Antigen (NBP1-83472PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IFTAP Antibody

  • chromosome 11 open reading frame 74
  • FLJ38678
  • HEPIS
  • hypothetical protein LOC119710
  • NWC
  • Protein HEPIS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5747
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-88509
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-02151
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-83472
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for IFTAP Antibody (NBP1-83472) (0)

There are no publications for IFTAP Antibody (NBP1-83472).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFTAP Antibody (NBP1-83472) (0)

There are no reviews for IFTAP Antibody (NBP1-83472). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for IFTAP Antibody (NBP1-83472) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFTAP Products

Bioinformatics Tool for IFTAP Antibody (NBP1-83472)

Discover related pathways, diseases and genes to IFTAP Antibody (NBP1-83472). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on IFTAP

There are no specific blogs for IFTAP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFTAP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C11ORF74