Home » HSFX1/2 » HSFX1/2 Antibodies » HSFX1/2 Antibody (1D7)

HSFX1/2 Antibody (1D7)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: HSFX1/2 Antibody (1D7) [H00051402-M01] - LW-1 monoclonal antibody (M01), clone 1D7 Analysis of LW-1 expression in A-431.
Western Blot: HSFX1/2 Antibody (1D7) [H00051402-M01] - LW-1 monoclonal antibody (M01), clone 1D7 Analysis of LW-1 expression in A-431.
Sandwich ELISA: HSFX1/2 Antibody (1D7) [H00051402-M01] - Detection limit for recombinant GST tagged LW-1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

HSFX1/2 Antibody (1D7) Summary

Immunogen
LW-1 (AAH21706, 1 a.a. ~ 423 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEDKRSLSMARCEERNSRGQDHGLERVPFPPQLQSETYLHPADPSPAWDDPGSTGSPNLRLLTEEIAFQPLAEEASFRRPHPDGDVPPQGEDNLLSLPFPQKLWRLVSSNQFSSIWWDDSGACRVINQKLFEKEILKRDVAHKVFATTSIKSFFRQLNLYGFRKRRQCTFRTFTRIFSAKRLVSILNKLEFYCHPYFQRDSPHLLVRMKRRVGVKSAPRHQEEDKPEAAGSCLAPADTEQQDHTSPNENDQVTPQHREPAGPNTQIRSGSAPPATPVMVPDSAVASDNSPVTQPAGEWSEGSQAHVTPVAAVPGPAALPFLYVPGSPTQMNSYGPVVALPTASRSTLAMDTTGLPAPGMLPFCHLWVPVTLVAAGAAQPAASMVMFPHLPALHHHCPHSHRTSQYMPASDGPQAYPDYADQST
Specificity
LW-1 - LW-1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HSFX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HSFX1/2 Antibody (1D7)

  • HSFX1 heat shock transcription factor family, X linked 1
  • HSFX2
  • LW-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

HSFY1 Antibody
NBP2-16888
Western Blot: HSFY1 Antibody [NBP2-16888] - Sample (50 ug of whole cell lysate) A: Rat testis, 10% SDS PAGE gel, diluted at 1:1000.
Western Blot: HSFY1 Antibody [NBP2-16888] - Sample (50 ug of whole cell lysate) A: Mouse Testis, 10% SDS PAGE gel, diluted at 1:1000.
Species: Mu, Rt
Applications: WB
DDX3Y Antibody
NBP2-92850
Western Blot: DDX3Y Antibody [NBP2-92850] - Analysis of extracts of various cell lines, using DDX3Y at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.
Immunocytochemistry/Immunofluorescence: DDX3Y Antibody [NBP2-92850] - Analysis of U-2 OS cells using DDX3Y. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: DDX3Y Antibody [NBP2-92850] - Rat testis using DDX3Y antibody at dilution of 1:100 (40x lens).
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
USP9Y Antibody
NBP1-79749
Western Blot: USP9Y Antibody [NBP1-79749] - Human Muscle lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB
RBMY1A1 Antibody
NBP1-32887
Western Blot: RBMY1A1 Antibody [NBP1-32887] - A. 30 ug NT2D1 whole cell lysate/extract, B. 30 ug PC-3 whole cell lysate/extract 7. 5 % SDS-PAGE gel, antibody dilution 1:1000.
Immunohistochemistry-Paraffin: RBMY1A1 Antibody [NBP1-32887] - Paraffin-embedded SAS Xenograft, using antibody at 1:100 dilution.
Species: Hu
Applications: WB, IHC, IHC-P
HSFY2 Antibody
(4B7)
H00159119-M02
Western Blot: HSFY2 Antibody (4B7) [H00159119-M02] - Analysis of HSFY2 expression in transfected 293T cell line by HSFY2 monoclonal antibody (M02), clone 4B7.Lane 1: HSFY2 transfected lysate (Predicted MW: 23.4 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: HSFY2 Antibody (4B7) [H00159119-M02] - Analysis of monoclonal antibody to HSFY2 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: HSFY2 Antibody (4B7) [H00159119-M02] - Detection limit for recombinant GST tagged HSFY2 is 0.1 ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
IL-6 [HRP]
D6050
(25 Reviews)
(463 Publications)
Species: Hu
DAZ1 Antibody
(3G10)
H00001617-M01
Western Blot: DAZ1 Antibody (3G10) [H00001617-M01] - DAZ1 monoclonal antibody (M01), clone 3G10. Analysis of DAZ1 expression in human pancreas.
Immunocytochemistry/Immunofluorescence: DAZ1 Antibody (3G10) [H00001617-M01] - Analysis of monoclonal antibody to DAZ1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: DAZ1 Antibody (3G10) [H00001617-M01] - Analysis of monoclonal antibody to DAZ1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1 ug/ml.
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Spermine synthase
Antibody (OTI3C9)
NBP2-00900
Western Blot: Spermine synthase Antibody (OTI3C9) [NBP2-00900] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Spermine synthase (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Spermine synthase.
Immunohistochemistry-Paraffin: Spermine synthase Antibody (OTI3C9) [NBP2-00900] - Staining of paraffin-embedded Human tonsil using anti-Spermine synthase mouse monoclonal antibody.
Flow Cytometry: Spermine synthase Antibody (OTI3C9) [NBP2-00900] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Spermine synthase antibody, and then analyzed by flow cytometry.
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MANBA Antibody
NBP3-04803
Western Blot: MANBA Antibody [NBP3-04803] - Analysis of extracts of various cell lines, using MANBA antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
Immunohistochemistry-Paraffin: MANBA Antibody [NBP3-04803] - Paraffin-embedded human liver cancer using MANBA antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: MANBA Antibody [NBP3-04803] - Paraffin-embedded human thyroid cancer using MANBA antibody at dilution of 1:100 (40x lens).
Species: Hu, Mu
Applications: WB, IHC
PGK1 Antibody
NBP2-19784
Western Blot: PGK1 Antibody [NBP2-19784] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with PGK1 antibody diluted at 1:3000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: PGK1 Antibody [NBP2-19784] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: PGK1 protein stained by PGK1 antibody diluted at 1:20. Red: alpha Tubulin, a cytoskeleton marker, stained by alpha Tubulin antibody [B-5-1-2] diluted at 1:10000.Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: PGK1 Antibody [NBP2-19784] - Analysis of paraffin-embedded hepatoma, using antibody at 1:500 dilution.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA
Kir6.2 Antibody
NBP2-76944
Western Blot: Kir6.2 Antibody [NBP2-76944] - Western blot analysis of Kir6.2 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody was used at a 1:500 dilution in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature.Positive control: Lane 1: Human liver tissue lysateLane 2: Mouse liver tissue lysate
Immunocytochemistry/Immunofluorescence: Kir6.2 Antibody [NBP2-76944] - ICC staining of Kir6.2 in LoVo cells (green). Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% Blocker BSA for 15 minutes at room temperature. Cells were probed with the antibody at a dilution of 1:200 for 1 hour at room temperature, washed with PBS. Alexa Fluor488 Goat anti-Rabbit IgG was used as the secondary antibody at 1/100 dilution. The nuclear counter stain is DAPI (blue).
Immunohistochemistry: Kir6.2 Antibody [NBP2-76944] - Immunohistochemical analysis of paraffin-embedded mouse liver tissue using anti-Kir6.2 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the antibody at 1/50 dilution, for 30 minutes at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. Counter stained with hematoxylin and mounted with DPX.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
ZNF41 Antibody
NBP2-49585
Immunocytochemistry/Immunofluorescence: ZNF41 Antibody [NBP2-49585] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ZNF41 Antibody [NBP2-49585] - Staining in human thyroid gland and pancreas tissues using anti-ZNF41 antibody. Corresponding ZNF41 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ZNF41 Antibody [NBP2-49585] - Staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
UTP14A Antibody
NBP2-93627
Western Blot: UTP14A Antibody [NBP2-93627] - Analysis of extracts of various cell lines, using UTP14A at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunohistochemistry-Paraffin: UTP14A Antibody [NBP2-93627] - Paraffin-embedded mouse brain using UTP14A.
Species: Hu, Mu
Applications: WB, IHC
Recombinant Human
FUNDC2 GST (N-Term) P ...
H00065991-P01
SDS-Page: Recombinant Human FUNDC2 Protein [H00065991-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
IL1RAPL2 Antibody
[Unconjugated]
AF1007
HepG2 human hepatocellular carcinoma cell line was stained with Goat Anti-Human IL1RAPL2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1007, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
Hepa 1‑6 mouse hepatoma cell line was stained with Goat Anti-Human IL1RAPL2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1007, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Signal sequence
receptor delta Antibo
NBP1-92390
Western Blot: Signal sequence receptor delta Antibody [NBP1-92390] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: Signal sequence receptor delta Antibody [NBP1-92390] - Staining of human kidney shows no positivity in cells in tubules as expected.
Western Blot: Signal sequence receptor delta Antibody [NBP1-92390] - Analysis of human dermal fibroblasts at 1:500 dilution. Image submitted by a verified customer review.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Myotubularin
Antibody
NBP1-86113
Immunocytochemistry/Immunofluorescence: Myotubularin Antibody [NBP1-86113] - Staining of human cell line U-251 MG shows localization to plasma membrane.
Immunohistochemistry-Paraffin: Myotubularin Antibody [NBP1-86113] - Staining of human testis shows moderate to strong cytoplasmic positivity in subsets of cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Myotubularin Antibody [NBP1-86113] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells (goblet cells).
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PGRMC1 Antibody
NBP1-83220
Western Blot: PGRMC1 Antibody [NBP1-83220] - Analysis in human liver tissue.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining in human liver and skeletal muscle tissues. Corresponding PGRMC1 RNA-seq data are presented for the same tissues.
Western Blot: PGRMC1 Antibody [NBP1-83220] - Analysis in human cell line HEK 293.
(12 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
DREF Antibody
(OTI5A2) - Azide and ...
NBP2-71419
Western Blot: DREF Antibody (OTI5A2) - Azide and BSA Free [NBP2-71419] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DREF.
Immunohistochemistry: DREF Antibody (OTI5A2) - Azide and BSA Free [NBP2-71419] - Analysis of Human pancreas tissue.
Flow Cytometry: DREF Antibody (OTI5A2) - Azide and BSA Free [NBP2-71419] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostaining by DREF1 antibody.
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
TMEM185A Antibody
NBP2-13448
Immunohistochemistry-Paraffin: TMEM185A Antibody [NBP2-13448] Staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.
Species: Hu
Applications: IHC, IHC-P

Publications for HSFX1/2 Antibody (H00051402-M01) (0)

There are no publications for HSFX1/2 Antibody (H00051402-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSFX1/2 Antibody (H00051402-M01) (0)

There are no reviews for HSFX1/2 Antibody (H00051402-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSFX1/2 Antibody (H00051402-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional HSFX1/2 Products

Bioinformatics Tool for HSFX1/2 Antibody (H00051402-M01)

Discover related pathways, diseases and genes to HSFX1/2 Antibody (H00051402-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSFX1/2 Antibody (H00051402-M01)

Discover more about diseases related to HSFX1/2 Antibody (H00051402-M01).
 

Pathways for HSFX1/2 Antibody (H00051402-M01)

View related products by pathway.

Blogs on HSFX1/2

There are no specific blogs for HSFX1/2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSFX1/2 Antibody (1D7) and receive a gift card or discount.


Bioinformatics

Gene Symbol HSFX1
Entrez
Uniprot