HSFX1/2 Antibody (1D7)

Images

 
Western Blot: HSFX1/2 Antibody (1D7) [H00051402-M01] - LW-1 monoclonal antibody (M01), clone 1D7 Analysis of LW-1 expression in A-431.
Sandwich ELISA: HSFX1/2 Antibody (1D7) [H00051402-M01] - Detection limit for recombinant GST tagged LW-1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HSFX1/2 Antibody (1D7) Summary

Immunogen
LW-1 (AAH21706, 1 a.a. ~ 423 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEDKRSLSMARCEERNSRGQDHGLERVPFPPQLQSETYLHPADPSPAWDDPGSTGSPNLRLLTEEIAFQPLAEEASFRRPHPDGDVPPQGEDNLLSLPFPQKLWRLVSSNQFSSIWWDDSGACRVINQKLFEKEILKRDVAHKVFATTSIKSFFRQLNLYGFRKRRQCTFRTFTRIFSAKRLVSILNKLEFYCHPYFQRDSPHLLVRMKRRVGVKSAPRHQEEDKPEAAGSCLAPADTEQQDHTSPNENDQVTPQHREPAGPNTQIRSGSAPPATPVMVPDSAVASDNSPVTQPAGEWSEGSQAHVTPVAAVPGPAALPFLYVPGSPTQMNSYGPVVALPTASRSTLAMDTTGLPAPGMLPFCHLWVPVTLVAAGAAQPAASMVMFPHLPALHHHCPHSHRTSQYMPASDGPQAYPDYADQST
Specificity
LW-1 - LW-1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HSFX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HSFX1/2 Antibody (1D7)

  • HSFX1 heat shock transcription factor family, X linked 1
  • HSFX2
  • LW-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16888
Species: Mu, Rt
Applications: WB
NBP2-92850
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-79749
Species: Hu
Applications: WB
NBP1-32887
Species: Hu
Applications: WB, IHC, IHC-P
H00159119-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
H00001617-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-00900
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP3-04803
Species: Hu, Mu
Applications: WB, IHC
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA
NBP2-76944
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49585
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-93627
Species: Hu, Mu
Applications: WB, IHC
AF1007
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-92390
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86113
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83220
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-71419
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-13448
Species: Hu
Applications: IHC, IHC-P

Publications for HSFX1/2 Antibody (H00051402-M01) (0)

There are no publications for HSFX1/2 Antibody (H00051402-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSFX1/2 Antibody (H00051402-M01) (0)

There are no reviews for HSFX1/2 Antibody (H00051402-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSFX1/2 Antibody (H00051402-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HSFX1/2 Products

Bioinformatics Tool for HSFX1/2 Antibody (H00051402-M01)

Discover related pathways, diseases and genes to HSFX1/2 Antibody (H00051402-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSFX1/2 Antibody (H00051402-M01)

Discover more about diseases related to HSFX1/2 Antibody (H00051402-M01).
 

Pathways for HSFX1/2 Antibody (H00051402-M01)

View related products by pathway.

Blogs on HSFX1/2

There are no specific blogs for HSFX1/2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSFX1/2 Antibody (1D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol HSFX1
Entrez
Uniprot