Recombinant Human HRAS like suppressor Protein

Images

 
SDS-Page: Recombinant Human HRAS like suppressor Protein [H00057110-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human HRAS like suppressor Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-168 of Human HRASLS full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAFNDCFSLNYPGNPCPGDLIEVFRPGYQHWALYLGDGYVINIAPVDGIPASFTSAKSVFSSKALVKMQLLKDVVGNDTYRINNKYDETYPPLPVEEIIKRSEFVIGQEVAYNLLVNNCEHFVTLLRYGEGVSEQANRAISTVEFVTAAVGVFSFLGLFPKGQRAKYY

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
HRASLS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
45.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HRAS like suppressor Protein

  • A-C1
  • HRAS-like suppressor
  • HRASLS1
  • H-REV107 protein-related protein
  • H-REV107
  • HSD28
  • phospholipase A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32569
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-56713
Species: Hu
Applications: WB, ICC/IF
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00008398-D01P
Species: Hu, Mu
Applications: WB
NBP2-59438
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-65875
Species: Hu
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
AF4925
Species: Mu
Applications: WB, Simple Western, IHC
7270-IL/CF
Species: Hu
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF

Publications for HRAS like suppressor Recombinant Protein (H00057110-P01) (0)

There are no publications for HRAS like suppressor Recombinant Protein (H00057110-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HRAS like suppressor Recombinant Protein (H00057110-P01) (0)

There are no reviews for HRAS like suppressor Recombinant Protein (H00057110-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HRAS like suppressor Recombinant Protein (H00057110-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for HRAS like suppressor Recombinant Protein (H00057110-P01)

Discover related pathways, diseases and genes to HRAS like suppressor Recombinant Protein (H00057110-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HRAS like suppressor Recombinant Protein (H00057110-P01)

Discover more about diseases related to HRAS like suppressor Recombinant Protein (H00057110-P01).
 

Pathways for HRAS like suppressor Recombinant Protein (H00057110-P01)

View related products by pathway.

PTMs for HRAS like suppressor Recombinant Protein (H00057110-P01)

Learn more about PTMs related to HRAS like suppressor Recombinant Protein (H00057110-P01).

Blogs on HRAS like suppressor

There are no specific blogs for HRAS like suppressor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-6 [Unconjugated]
7270-IL-025/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HRAS like suppressor Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HRASLS