HOXC6 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

HOXC6 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HOXC6.

  Source: E. coli

  Amino Acid Sequence: SYFTNPSLSCHLAGGQDVLPNVALNSTAYDPVRHFSTYGAAVAQNRIYSTPFYSPQENVVFSSSRGPYDYGSNSFYQEKDMLSNCRQNTLGHNTQTSIAQDFSSEQ

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: HOXC6
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54948.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HOXC6 Recombinant Protein Antigen

• CP25
• HHO.C8
• homeo box 3C
• homeo box C6
• homeo box C8 protein
• homeobox C6
• Homeobox protein CP25
• Homeobox protein HHO.C8
• Homeobox protein Hox-3C
• homeobox protein Hox-C6
• HOX3CHOX3

Background

The Hox proteins play a role in development and cellular differentiation by regulating downstream target genes. Specifically, the Hox proteins direct DNA-protein and protein-protein interactions that assist in determining the morphologic features associated with the anterior-posterior body axis. The mammalian Hox gene complex consists of 39 genes that are located on four linkage groups, which are dispersed over four chromosomes. Hox genes that occupy the same relative position along the 5' to 3' coordinate (trans-paralogous genes) are more similar in sequence and expression pattern than adjacent Hox genes on the same chromosome. HoxC6 sequence-specific transcription factor is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. HoxC6 may be a novel potential therapeutic target for prostate cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: HOXC6