HOXC6 Antibody

Images

 
Western Blot: HOXC6 Antibody [NBP2-85070] - Host: Rabbit. Target Name: HOXC6. Sample Tissue: Mouse Kidney lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOXC6 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse HOXC6. Peptide sequence: VRHFSTYGAAVAQNRIYSTPFYSPQENVVFSSSRGPYDYGSNSFYQEKDM The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
HOXC6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HOXC6 Antibody

  • CP25
  • HHO.C8
  • homeo box 3C
  • homeo box C6
  • homeo box C8 protein
  • homeobox C6
  • Homeobox protein CP25
  • Homeobox protein HHO.C8
  • Homeobox protein Hox-3C
  • homeobox protein Hox-C6
  • HOX3CHOX3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52085
Species: Hu, Mu
Applications: PEP-ELISA, WB
NBP2-46001
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-85076
Species: Hu
Applications: WB
NBP2-24561
Species: Bv, Fe, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
H00003222-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, S-ELISA, WB
H00003204-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP2-56195
Species: Hu
Applications: ICC/IF, WB
H00003213-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00003231-M01
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP3-06103
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
H00003232-M09
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-45744
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-91803
Species: Hu
Applications: IHC, IHC-P, WB
H00005688-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP2-42520
Species: Hu, Po
Applications: IHC-P, PEP-ELISA, WB
H00003217-M03
Species: Hu, Rb
Applications: ELISA, Func, IHC, IHC-P, WB
H00003237-M10
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
DGB300
Species: Hu
Applications: ELISA
NBP2-32515
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for HOXC6 Antibody (NBP2-85070) (0)

There are no publications for HOXC6 Antibody (NBP2-85070).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXC6 Antibody (NBP2-85070) (0)

There are no reviews for HOXC6 Antibody (NBP2-85070). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXC6 Antibody (NBP2-85070) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXC6 Products

Bioinformatics Tool for HOXC6 Antibody (NBP2-85070)

Discover related pathways, diseases and genes to HOXC6 Antibody (NBP2-85070). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXC6 Antibody (NBP2-85070)

Discover more about diseases related to HOXC6 Antibody (NBP2-85070).
 

Pathways for HOXC6 Antibody (NBP2-85070)

View related products by pathway.

PTMs for HOXC6 Antibody (NBP2-85070)

Learn more about PTMs related to HOXC6 Antibody (NBP2-85070).

Blogs on HOXC6

There are no specific blogs for HOXC6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXC6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXC6