Recombinant Human HOXC5 Protein

Images

 
SDS-Page: HOXC5 Recombinant Protein [H00003222-P01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HOXC5 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 222 of Human HOXC5 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPRAHPDRPACSAAAAPGHAPGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQTGQPAGLSQPPAPPQIYPWMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSKEAL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
HOXC5
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HOXC5 Protein

  • homeo box C5
  • homeobox C5
  • Homeobox protein CP11
  • Homeobox protein Hox-3D
  • homeobox protein Hox-C5
  • HOX3
  • HOX3DCP11

Background

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC5, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants have been described for HOXC5. The transcript variant which includes the shared exon apparently doesn't encode a protein. The protein-coding transcript variant contains gene-specific exons only. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56195
Species: Hu
Applications: WB, ICC/IF
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003223-M04
Species: Hu
Applications: WB, ELISA
NBP2-55738
Species: Hu
Applications: ICC/IF
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45744
Species: Hu
Applications: WB, IHC
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-14098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58710
Species: Hu
Applications: WB, ICC/IF
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
NBP2-32515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-52085
Species: Hu, Mu
Applications: WB, PEP-ELISA
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBP2-58808
Species: Hu
Applications: WB, ICC/IF
NBP2-57662
Species: Hu
Applications: ICC/IF
NBP1-83234
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC

Publications for HOXC5 Recombinant Protein (H00003222-P01) (0)

There are no publications for HOXC5 Recombinant Protein (H00003222-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXC5 Recombinant Protein (H00003222-P01) (0)

There are no reviews for HOXC5 Recombinant Protein (H00003222-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXC5 Recombinant Protein (H00003222-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOXC5 Products

Bioinformatics Tool for HOXC5 Recombinant Protein (H00003222-P01)

Discover related pathways, diseases and genes to HOXC5 Recombinant Protein (H00003222-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXC5 Recombinant Protein (H00003222-P01)

Discover more about diseases related to HOXC5 Recombinant Protein (H00003222-P01).
 

Pathways for HOXC5 Recombinant Protein (H00003222-P01)

View related products by pathway.

Blogs on HOXC5

There are no specific blogs for HOXC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HOXC5 Antibody
NBP1-81718
GLI-1 Antibody
NB600-600

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HOXC5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXC5