HOXC5 Recombinant Protein Antigen

Images

 
There are currently no images for HOXC5 Protein (NBP1-81718PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HOXC5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HOXC5.

Source: E. coli

Amino Acid Sequence: PGHAPGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQTGQPAGLSQPPAPPQIYPWMT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HOXC5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81718.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HOXC5 Recombinant Protein Antigen

  • homeo box C5
  • homeobox C5
  • Homeobox protein CP11
  • Homeobox protein Hox-3D
  • homeobox protein Hox-C5
  • HOX3
  • HOX3DCP11

Background

HOXC5 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC5, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants have been described for HOXC5. The transcript variant which includes the shared exon apparently doesn't encode a protein. The protein-coding transcript variant contains gene-specific exons only. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-44809
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00003223-M04
Species: Hu
Applications: ELISA, WB
NBP3-45002
Species: Hu
Applications: IHC, WB
H00003232-M09
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-45744
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00003237-M10
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00003217-M03
Species: Hu, Rb
Applications: ELISA, Func, IHC,  IHC-P, WB
H00003231-M01
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
NBP2-32515
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83235
Species: Hu
Applications: IHC,  IHC-P, WB
H00003224-M01
Species: Hu
Applications: ELISA, IHC, IHC-Fr, S-ELISA, WB
H00003204-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP3-17383
Species: Hu
Applications: ICC/IF,  IHC-P
NBP3-09362
Species: Hu
Applications: WB
NBP2-85008
Species: Hu, Mu
Applications: WB
NBP2-24561
Species: Bv, Fe, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC,  IHC-P, KD, WB

Publications for HOXC5 Protein (NBP1-81718PEP) (0)

There are no publications for HOXC5 Protein (NBP1-81718PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXC5 Protein (NBP1-81718PEP) (0)

There are no reviews for HOXC5 Protein (NBP1-81718PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HOXC5 Protein (NBP1-81718PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOXC5 Products

Blogs on HOXC5

There are no specific blogs for HOXC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HOXC5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXC5