HOXC12 Antibody (2E9.)

Images

 
ELISA: HOXC12 Antibody (2E9) [H00003228-M03] - Detection limit for recombinant GST tagged HOXC12 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2E9.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HOXC12 Antibody (2E9.) Summary

Immunogen
HOXC12 (NP_776272, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGEHNLLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLSWPSAEPCNGYPQPYLGSPVSLNPPFGRTCELARVEDGKGYYREPCA
Specificity
HOXC12 (2E9)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOXC12
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXC12 Antibody (2E9.)

  • HOC3F
  • homeo box 3F
  • homeo box C12
  • homeobox C12
  • Homeobox protein Hox-3F
  • homeobox protein Hox-C12
  • HOX3FHOX3

Background

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45744
Species: Hu
Applications: WB, IHC
NBP2-55738
Species: Hu
Applications: ICC/IF
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-58710
Species: Hu
Applications: WB, ICC/IF
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-14098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57662
Species: Hu
Applications: ICC/IF
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP2-47428
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83234
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBP1-80228
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-58808
Species: Hu
Applications: WB, ICC/IF
AF6318
Species: Hu
Applications: ICC
H00003228-M03
Species: Hu
Applications: WB, ELISA

Publications for HOXC12 Antibody (H00003228-M03) (0)

There are no publications for HOXC12 Antibody (H00003228-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXC12 Antibody (H00003228-M03) (0)

There are no reviews for HOXC12 Antibody (H00003228-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXC12 Antibody (H00003228-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXC12 Products

Bioinformatics Tool for HOXC12 Antibody (H00003228-M03)

Discover related pathways, diseases and genes to HOXC12 Antibody (H00003228-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXC12 Antibody (H00003228-M03)

Discover more about diseases related to HOXC12 Antibody (H00003228-M03).
 

Pathways for HOXC12 Antibody (H00003228-M03)

View related products by pathway.

PTMs for HOXC12 Antibody (H00003228-M03)

Learn more about PTMs related to HOXC12 Antibody (H00003228-M03).

Blogs on HOXC12

There are no specific blogs for HOXC12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXC12 Antibody (2E9.) and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXC12
Entrez
OMIM
Uniprot